Übersicht der SEO Analyse
Metaangaben
85% 
Seitenqualität
39% 
Seitenstruktur
75% 
Verlinkung
97% 
Server
68% 
Externe Faktoren
55% 
SEO Score
Antwortzeit
0,77 s
Dateigröße
278,60 kB
Wörter
70
Medien
13
Anzahl Links
23 Intern / 8 Extern

To-do Liste mit SEO Optimierungen

Meta-Angaben im HTML

Titel
(Extrem wichtig)
Fremdenverkehrsverein Garmisch-Partenkirchen e.V.
Die Länge des Titels ist optimal. (477 Pixel von maximal 580 Pixel Länge)
Es gibt keine Wortwiederholungen im Titel.
Meta-Description
(Extrem wichtig)
Garmisch-Partenkirchen – der bekannte Kurort nahe der Zugspitze. Infos zu Hotels, Gästehäusern und Ferienwohnungen für Ihren Ski- und Wanderurlaub in den Alpen.
Die Meta-Description ist zu lang. (1038 Pixel von maximal 1000 Pixel) Jetzt optimieren
Crawlbarkeit
(Extrem wichtig)
Es gibt keine Probleme beim Zugriff auf die Webseite.
Canonical Link
(Wichtig)
https://www.fvv-gapa.de/
Die Seite hat einen korrekten Canonical Link.
Sprache
(Wenig wichtig)
Im Text erkannte Sprache: de
Im HTML angegebene Sprache: de
Serverstandort: Vereinigte Staaten von Amerika
Die Sprache wird im HTML Code wie folgt angegeben: de
Alternate/Hreflang Links
(Wenig wichtig)
Die Seite nutzt keine Alternate Links.
Weitere Metatags
(Wenig wichtig)
Es gibt keinen rel next Meta Tag auf der Seite.
Es gibt keinen rel prev Meta Tag auf der Seite.
Domain
(Wenig wichtig)
Die Domain ist keine Subdomain.
Die Länge der Domain ist gut.
Die Domain enthält keine Umlaute.
Seiten URL
(Wenig wichtig)
In der URL wurden keine Parameter entdeckt.
In der URL wurde keine Session ID entdeckt.
Die URL hat nicht zu viele Unterverzeichnisse.
Zeichensatzkodierung
(Wenig wichtig)
Die Angaben zur Zeichensatzkodierung (UTF-8) sind fehlerfrei.
Doctype
(Nice to have)
Die Doctype Angabe HTML 5 ist korrekt angegeben.
Die Doctype Angabe befindet sich an erster Stelle im HTML-Code.
Favicon
(Nice to have)
Das Favoriten Icon (Favicon) ist korrekt verlinkt.

Meta Tags

NameWert
generatorWix.com Website Builder
format-detectiontelephone=no
SKYPE_TOOLBARSKYPE_TOOLBAR_PARSER_COMPATIBLE
viewportwidth=980, user-scalable=yes
descriptionGarmisch-Partenkirchen – der bekannte Kurort nahe der Zugspitze. Infos zu Hotels, Gästehäusern und Ferienwohnungen für Ihren Ski- und Wanderurlaub in den Alpen.
fb_admins_meta_tagfremdenverkehrsverein.gapa
google-site-verificationl4qv66Ve-hOEGuWsep5MTFS4pepxGCaDfKMGwBvdZXs
keywordsBuchung, Ferienwohnung, Garmisch-Partenkirchen, Gastgeber, Gästehaus, Hotel, Pension, Unterkunft, Zimmer, Zugspitze
langde
fb:adminsfremdenverkehrsverein.gapa
og:titleFremdenverkehrsverein Garmisch-Partenkirchen e.V.
og:descriptionGarmisch-Partenkirchen – der bekannte Kurort nahe der Zugspitze. Infos zu Hotels, Gästehäusern und Ferienwohnungen für Ihren Ski- und Wanderurlaub in den Alpen.
og:imagehttps://static.wixstatic.com/media/d12b0a_4372f257c1f94c179cef83b3b174731f%7Emv2.jpg/v1/fit/w_2500,h_1330,al_c/d12b0a_4372f257c1f94c179cef83b3b174731f%7Emv2.jpg
og:urlhttps://www.fvv-gapa.de
og:site_namefvv-gapa
og:typewebsite
X-UA-CompatibleIE=Edge
X-Wix-Meta-Site-Ide2f86fcd-c0f6-49f3-9a96-f8f7c0a444e6
X-Wix-Application-Instance-Id139432dd-80cb-4b5f-ae94-aa4c2f7bfb84
X-Wix-Published-Version1668
charsetutf-8

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von fvv-gapa.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Seitenqualität

Inhalt
(Extrem wichtig)
Die Wortzahl ist mit 70 Worten zu gering. Die Textlänge sollte mindestens 250 Wörter betragen.
Es wurden keine Textblöcke erkannt.
Der Text besteht zu 24.3% aus Füllwörtern.
Worte aus dem Titel werden im Text wiederholt.
Im Text befindet sich eine Aufzählung, dies deutet auf eine gute Textstruktur hin.
Es wurden keine Platzhalter Texte bzw. Bilder gefunden.
Frames
(Extrem wichtig)
Die Seite hat kein Frameset.
Mobile
(Wenig wichtig)
Die Webseite lädt 6 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Der angegebene Viewport (width=980, user-scalable=yes) ist korrekt.
Mindestens ein Apple-Touch Icon ist definiert.
Bold- und Strongtags
(Wenig wichtig)
Die Nutzung von Strong- und Bold-Tags ist optimal. Wir empfehlen für diese Webseite die Verwendung von bis zu 6 Tags.
Bilder Optimierung
(Wenig wichtig)
Bei 9 Bildern fehlt das Alt-Attribut. Der Inhalt von Alt-Attributen wird von Suchmaschinen auch als Text gewertet und ist wichtig für die Bildersuche.
Soziale Vernetzung
(Nice to have)
Es befinden sich wenige Social-Sharing Möglichkeiten auf der Seite. Mit Plugins zum Teilen, kann die Reichweite der Seite in sozialen Netzwerken erhöht werden.
Zusätzliches Markup
(Nice to have)
Es wurde kein zusätzliches Markup gefunden.
HTTPS
(Wenig wichtig)
Die Seite verwendet HTTPS um Daten sicher zu übertragen.
Alle eingebundenen Dateien werden ebenfalls über HTTPS ausgeliefert.

Medienliste

Seitenstruktur

H1 Überschrift
(Extrem wichtig)
Es ist keine H1-Überschrift definiert.
Überschriften
(Wichtig)
Einige Überschriftentexte kommen doppelt auf der Seite vor.
Die Überschriftenstruktur ist fehlerhaft. Es sollte keine Hierarchie (H1-H6) ausgelassen werden.

Überschriftenstruktur

Überschriften HierarchieInhalt
H2 Facebook
H2 Instagram
H4 FREMDEN
H4 VERKEHRS
H4 VEREIN
H4 Garmisch-Partenkirchen
H4 UNTERKÜNFTE
H4 VEREIN Text-Duplikat
H4 VERANSTALTUNGEN & AKTIVITÄTEN
H4 KONTAKT
H5 Folgen Sie uns:
H5 Unsere Partner:
1 Links haben keinen Linktext oder nur Inhalt in Alt- und Titelattributen.
Die Anzahl an internen Links ist ok.
Alle Linktexte sind einzigartig.
Keiner der Linktexte ist zu lang.
Alle internen Links haben keine dynamischen Parameter.
Es befinden sich 8 externe Links auf der Seite.
LinkAttributeLinktext
https://www.fvv-gapa.de/Kein Text
https://www.fvv-gapa.de/Home
/direktbuchungUnterkünfte
/gastronomieGastronomie
https://www.fvv-gapa.de/vereinVerein
/aktivitaetenAktivitäten
https://www.fvv-gapa.de/webcamsWebcams
/direktbuchungBuchungsanfrage
https://www.skiweltcup-garmisc...Neues Fenster Extern IMG-ALT Ski WM 2025.png
/direktbuchungKein Text
https://www.fvv-gapa.de/hotelsHotels entdecken
/gaestehaeuserGästehäuser entdecken
/ferienwohnungenFerienwohnungen entdecken
/direktbuchungBuchungsanfrage senden
https://www.fvv-gapa.de/vereinMehr über den Fremdenverkehrsverein erfahren
https://www.fvv-gapa.de/vereinInformationen zur Vereinsmitgliedschaft ansehen
/veranstaltungenKommende Veranstaltungen ansehen
/aktivitaetenMehr über die Aktivitäten des Vereins erfahren
https://www.fvv-gapa.de/kontaktFragen, Wünsche oder Anregungen zum Verein?
https://www.fvv-gapa.de/kontaktKontakt zu Garmisch-Partenkirchen Tourismus und Bayerische Zugspitzbahn
https://www.facebook.com/fremd...Neues Fenster Extern IMG-ALT Facebook - White Circle
https://www.instagram.com/frem...Neues Fenster Extern IMG-ALT Instagram - White Circle
https://www.facebook.com/fremd...Neues Fenster Extern Facebook
https://www.instagram.com/frem...Neues Fenster Extern Instagram
https://www.gapa.de/Neues Fenster Extern Kein Text
https://www.zugspitze.de/Neues Fenster Extern IMG-ALT BZB_TOP_Marke_CMYK_RZ.png
https://www.gaestefuehrer-garm...Neues Fenster Extern Kein Text
https://www.fvv-gapa.de/kontaktKontakt
https://www.fvv-gapa.de/sitemapSitemap
/datenschutzDatenschutz
https://www.fvv-gapa.de/impressumImpressum

Serverkonfiguration

HTTP-Weiterleitungen
(Extrem wichtig)
Die geprüfte Seite leitet nicht auf eine andere URL weiter.
HTTP-Header
(Wichtig)
Die Webserver Version wird im Header mitgesendet.
Es wird kein X-Powered HTTP-Header mitgesendet.
Der Webserver nutzt GZip zur komprimierten Übertragung der Webseite (HTML).
Performance
(Wenig wichtig)
Die Antwortzeit der HTML-Seite ist mit 0,77 Sekunden länger als die empfohlene Zeit von maximal 0,4 Sekunden. Eine hohe Antwortzeit verlängert unnötig das Crawling und sorgt für eine schlechte User Experience.
Die Webseite lädt 6 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Webseite lädt nur wenige CSS Dateien (1).
Die Dateigröße des HTML-Dokuments ist mit 279 kB in Ordnung.

HTTP-Header

NameWert
dateSat, 15 Aug 2020 02:13:24 GMT
content-typetext/html;charset=utf-8
transfer-encodingchunked
connectionkeep-alive
set-cookie52 Zeichen
set-cookie270 Zeichen
set-cookie85 Zeichen
expiresThu, 01 Jan 1970 00:00:00 GMT
server-timingcache;desc=none
x-wix-request-id1597457604.32623933969417769
cache-controlno-cache
content-languagede
varyUser-Agent, Accept-Encoding
content-encodinggzip
x-seen-bysHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkViqBWu3DBdI545IRAYIe9BF,2d58ifebGbosy5xc+FRaloPX4ngKfQM8fEHbwELHijkWKkMTwl3pDzCQIN4bfX1aWIHlCalF7YnfvOr2cMPpyw==,Nlv1KFVtIvAfa3AK9dRsI891F5cPV4/7uVPnrpzkrLRWd3xniMsr1HjrszKGvMzr,qquldgcFrj2n046g4RNSVAiOxhA7Vkxnx3Qqcd3yJLo=,w4q8mm9FnmU4emOs6psVXZNzSy765clhbXwYVNhjeUlNG+KuK+VIZfbNzHJu0vJu,x1Sj9Xv8W8xC18ngt0x3M8d5jD6G4J/PAhlkHd0nhFQaMbO94PXqPUKnqbitcEEXvGQ2Otd3B2C27oTTIAKJtQ==,w4q8mm9FnmU4emOs6psVXZNzSy765clhbXwYVNhjeUlNG+KuK+VIZfbNzHJu0vJu,l7Ey5khejq81S7sxGe5Nkxb8Vux5/tRs+uT2vOK2NHGTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ+Wwo8Xxk6ZL7pfzbON6TIfGN5giiaFqmCG1o/KNJYqWfDQdED9/I5ehOHwS0eiNrm0IvDirFYd/yjjx7YUj5MizEBnQcZuzT60=,l7Ey5khejq81S7sxGe5Nk4RlUDwBNoQpzubkkp0vSTWTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LlHHrtdZwfqSTe7u8ayFI0keLYjVZkS1inkjEVOiCd/UMW1Qp75ae6/SPicsFPGK2+ZYI/Y/vgIRvS70e3vsag==,m7d0zj9X6FBqkyAIyh66vFYo0K4GYxYwm8rCLRUSsi9NG+KuK+VIZfbNzHJu0vJu,CU5GbgCT5nWPaA3tUS4mLEV6GiqBJ2BXHbVLi5DxZkG+vGkmYhU5imhNdwwxzhRJHuPmCxSGZ+T+dHEqDDvuNQ==
serverPepyaka/1.15.10
statuscode200
http_versionHTTP/1.1

Externe Faktoren

Blacklists
(Extrem wichtig)
Die Seite ist nicht auf der Shallalist verzeichnet.
Die Seite wird nur ein wenig von anderen Webseiten verlinkt.
Die Seite hat nur Backlinks von 16 verweisenden Domains.
Die Seite hat insgesamt nur 102 Backlinks.
Die Seite hat nur wenige Backlinks von 15 verschiedenen IP Adressen.
Verbreitung bei Facebook
(Wenig wichtig)
Die Seite ist bei Facebook kaum relevant.
Eintrag bei Webwiki
(Nice to have)
Die Seite ist nicht bei Webwiki verzeichnet, kann aber eingetragen werden.

Links von Wikipedia

Es wurden keine Links von Wikipedia gefunden.

Robots.txt

User-agent: *
Allow: /

# Optimization for Google Ads Bot
User-Agent: AdsBot-Google-Mobile
User-Agent: AdsBot-Google
Disallow: /_api/*
Disallow: /_partials*
Disallow: /pro-gallery-webapp/v1/galleries/*

Sitemap: https://www.fvv-gapa.de/sitemap.xml

Popularität bei Facebook

Shares / Likes / Kommentare
0

Es werden nur die Daten zu der angegebenen URL abgefragt und nicht zu einer eventuell vorhandenen und auf der Seite verlinkten Facebook Seite.

Suchvorschau

www.fvv-gapa.de
Fremdenverkehrsverein Garmisch-Partenkirchen e.V.
Garmisch-Partenkirchen – der bekannte Kurort nahe der Zugspitze. Infos zu Hotels, Gästehäusern und Ferienwohnungen für Ihren Ski- und Wanderurlaub in den Alpen.

Wichtigste Suchbegriffe

Folgende Keywords hat Seobility erkannt. Überprüfe die Optimierung dieser Keywords für Deine Seite.

KeywordErgebnisPrüfen
Garmisch-Partenkirchen52%Check
Verein45%Check
Fremdenverkehrsverein Garmisch-Partenkirchen44%Check
Fremdenverkehrsverein35%Check
Ferienwohnungen35%Check
Gästehäuser35%Check
Hotels35%Check
Facebook28%Check
Instagram28%Check
Unterkünfte26%Check

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von fvv-gapa.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich