Sytskeveenstra.nl - SEO Check

Übersicht der SEO Analyse
Metaangaben
67% 
Seitenqualität
36% 
Seitenstruktur
79% 
Verlinkung
92% 
Server
97% 
Externe Faktoren
23% 
SEO Score
Antwortzeit
0,02 s
Dateigröße
8,60 kB
Wörter
196
Medien
17
Anzahl Links
5 Intern / 7 Extern

To-do Liste mit SEO Optimierungen

Meta-Angaben im HTML

Titel
(Extrem wichtig)
Amoeba | grafisch ontwerp
Die Länge des Titels ist optimal. (242 Pixel von maximal 580 Pixel Länge)
Es gibt keine Wortwiederholungen im Titel.
Meta-Description
(Extrem wichtig)
Die Meta-Description fehlt.
Crawlbarkeit
(Extrem wichtig)
Es gibt keine Probleme beim Zugriff auf die Webseite.
Canonical Link
(Wichtig)
Es ist kein Canonical Link angegeben.
Sprache
(Wenig wichtig)
Im Text erkannte Sprache: nl
Im HTML angegebene Sprache: en
Serverstandort: Niederlande
Die angegebene Sprache en stimmt nicht mit der im Text erkannten Sprache nl überein.
Alternate/Hreflang Links
(Wenig wichtig)
Die Seite nutzt keine Alternate Links.
Weitere Metatags
(Wenig wichtig)
Es gibt keinen rel next Meta Tag auf der Seite.
Es gibt keinen rel prev Meta Tag auf der Seite.
Domain
(Wenig wichtig)
Die Domain ist keine Subdomain.
Die Länge der Domain ist gut.
Die Domain enthält keine Umlaute.
Seiten URL
(Wenig wichtig)
In der URL wurden keine Parameter entdeckt.
In der URL wurde keine Session ID entdeckt.
Die URL hat nicht zu viele Unterverzeichnisse.
Zeichensatzkodierung
(Wenig wichtig)
Die Zeichensatzkodierung ist nicht im HTTP Header angegeben.
Die Angaben zur Zeichensatzkodierung (UTF-8) sind fehlerfrei.
Doctype
(Nice to have)
Die Doctype Angabe HTML 5 ist korrekt angegeben.
Die Doctype Angabe befindet sich an erster Stelle im HTML-Code.
Favicon
(Nice to have)
Es ist kein Favoriten Icon (Favicon) im HTML-Code verlinkt.

Meta Tags

NameWert
viewportwidth=device-width, initial-scale=1
langen
X-UA-CompatibleIE=edge
charsetutf-8

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von sytskeveenstra.nl!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Seitenqualität

Inhalt
(Extrem wichtig)
Die Wortzahl ist mit 196 Worten zu gering. Die Textlänge sollte mindestens 250 Wörter betragen.
Der Text besteht zu 31.6% aus Füllwörtern.
Worte aus dem Titel werden im Text wiederholt.
Im Text befindet sich eine Aufzählung, dies deutet auf eine gute Textstruktur hin.
Es wurden 4 Fließtextblöcke auf der Seite gefunden.
Es wurden keine Platzhalter Texte bzw. Bilder gefunden.
Es befinden sich keine Duplikate auf der Seite.
Die durchschnittliche Satzlänge ist mit 12.5 Wörtern gut.
Frames
(Extrem wichtig)
Die Seite hat kein Frameset.
Mobile
(Wenig wichtig)
Es ist kein Apple-Touch Icon angegeben.
Der angegebene Viewport (width=device-width, initial-scale=1) ist korrekt.
Die Webseite benötigt nur wenige JavaScript Dateien (3).
Bold- und Strongtags
(Wenig wichtig)
Die Nutzung von Strong- und Bold-Tags ist optimal. Wir empfehlen für diese Webseite die Verwendung von bis zu 6 Tags.
Bilder Optimierung
(Wenig wichtig)
Bei 17 Bildern fehlt das Alt-Attribut. Der Inhalt von Alt-Attributen wird von Suchmaschinen auch als Text gewertet und ist wichtig für die Bildersuche.
Soziale Vernetzung
(Nice to have)
Es befinden sich wenige Social-Sharing Möglichkeiten auf der Seite. Mit Plugins zum Teilen, kann die Reichweite der Seite in sozialen Netzwerken erhöht werden.
Zusätzliches Markup
(Nice to have)
Es wurde kein zusätzliches Markup gefunden.
HTTPS
(Wenig wichtig)
Das Protokoll HTTPS zur sicheren Übertragung von Daten wird nicht verwendet.

Medienliste

URLALT-AttributeTitel
http://sytskeveenstra.nl/img/logo2.pngKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/logo.pngKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port11.jpgKein ALT-Attribut angegeben
/img/portfolio01.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port02.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port05.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port06.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port12.jpgKein ALT-Attribut angegeben
/img/portfolio02.jpgKein ALT-Attribut angegeben
/img/portfolio04.jpgKein ALT-Attribut angegeben
/img/portfolio03.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port10.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port01.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port04.jpgKein ALT-Attribut angegeben
/img/portfolio05.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port07.jpgKein ALT-Attribut angegeben
http://sytskeveenstra.nl/img/port08.jpgKein ALT-Attribut angegeben

Seitenstruktur

H1 Überschrift
(Extrem wichtig)
Es ist keine H1-Überschrift definiert.
Überschriften
(Wichtig)
Die Überschriftenstruktur ist fehlerhaft. Es sollte keine Hierarchie (H1-H6) ausgelassen werden.

Überschriftenstruktur

Überschriften HierarchieInhalt
H2 Wat doet Amoeba voor jou?
H2 werk
H2 contact
H3 Wat kan nog meer?
H3 Waarom Amoeba?
H3 Het hart van Amoeba
Es befinden sich zu wenige (5) interne Links auf der Seite.
Alle Linktexte sind einzigartig.
Keiner der Linktexte ist zu lang.
Alle internen Links haben keine dynamischen Parameter.
Es befinden sich 7 externe Links auf der Seite.
LinkAttributeLinktext
/index.htmlthuis
http://sytskeveenstra.nl/Anchor over
http://sytskeveenstra.nl/Anchor werk
http://sytskeveenstra.nl/Anchor contact
https://www.visserendegraef.nl/Extern Kein Text
https://www.visserendegraef.nl/Extern Kein Text
https://www.visserendegraef.nl/Extern Kein Text
https://www.visserendegraef.nl/Extern Kein Text
https://www.google.nl/maps/pla...Extern Leeuwarden
https://www.linkedin.com/in/sy...Extern Kein Text
/privacyverklaring.htmlprivacyverklaring
http://www.themesity.com/Neues Fenster Nofollow Extern Themesity

Serverkonfiguration

HTTP-Weiterleitungen
(Extrem wichtig)
Die geprüfte Seite leitet nicht auf eine andere URL weiter.
HTTP-Header
(Wichtig)
Es wird kein X-Powered HTTP-Header mitgesendet.
Der Webserver nutzt GZip zur komprimierten Übertragung der Webseite (HTML).
Performance
(Wenig wichtig)
Die Webseite lädt 4 CSS Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Antwortzeit der HTML-Seite ist mit 0,02 Sekunden unter der Zielmarke von 0,40 Sekunden.
Die Webseite benötigt nur wenige JavaScript Dateien (3).
Die Dateigröße des HTML-Dokuments ist mit 9 kB in Ordnung.

HTTP-Header

NameWert
dateTue, 27 Oct 2020 15:24:34 GMT
serverApache/2
upgradeh2,h2c
connectionUpgrade
last-modifiedTue, 03 Sep 2019 08:28:21 GMT
etag"2242-591a1df059340-gzip"
accept-rangesbytes
varyAccept-Encoding,User-Agent
content-encodinggzip
content-length3073
content-typetext/html
statuscode200
http_versionHTTP/1.1

Externe Faktoren

Blacklists
(Extrem wichtig)
Die Seite ist nicht auf der Shallalist verzeichnet.
Die Seite wird nur ein wenig von anderen Webseiten verlinkt.
Die Seite hat nur Backlinks von 1 verweisenden Domains.
Die Seite hat insgesamt nur 1 Backlinks.
Die Seite hat nur wenige Backlinks von 1 verschiedenen IP Adressen.
Verbreitung bei Facebook
(Wenig wichtig)
Die Seite ist bei Facebook kaum relevant.
Eintrag bei Webwiki
(Nice to have)
Die Seite ist nicht bei Webwiki verzeichnet, kann aber eingetragen werden.

Links von Wikipedia

Es wurden keine Links von Wikipedia gefunden.

Robots.txt

Es wurde keine valide Robots.txt Datei gefunden.

Popularität bei Facebook

Shares / Likes / Kommentare
0

Es werden nur die Daten zu der angegebenen URL abgefragt und nicht zu einer eventuell vorhandenen und auf der Seite verlinkten Facebook Seite.

Suchvorschau

sytskeveenstra.nl
Amoeba | grafisch ontwerp

Wichtigste Suchbegriffe

Folgende Keywords wurden erkannt. Überprüfe die Optimierung dieser Keywords für Deine Seite.

KeywordErgebnisPrüfen
Amoeba54%Check
doet Amoeba48%Check
ontwerp46%Check
grafisch46%Check
sytskeveenstra46%Check
Veenstra46%Check
Sytske46%Check
grafisch ontwerp46%Check
werk38%Check
contact38%Check

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von sytskeveenstra.nl!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich