Tischtennis.biz - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
100% 
Page quality
71% 
Page structure
100% 
Link structure
25% 
Server
78% 
External factors
34% 
SEO Score
Response time
1.24 s
File size
90.40 kB
Words
911
Media files
13
Number of links
189 internal / 1 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Beton Tischtennisplatten besonders günstig kaufen
The length of the page title is perfect. (458 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Beton Tischtennisplatten für Schulen in großer Auswahl ✓ sparen Sie 22% ✓ 1A Qualität ✓ Top Bewertung ✓ versandkostenfrei ✓ jetzt kaufen bei Tischtennis.biz
The length of the meta description is perfect. (989 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.tischtennis.biz/beton-tischtennistische/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de
Server location: United States of America
The following language is defined by HTML: de
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1
descriptionBeton Tischtennisplatten für Schulen in großer Auswahl ✓ sparen Sie 22% ✓ 1A Qualität ✓ Top Bewertung ✓ versandkostenfrei ✓ jetzt kaufen bei Tischtennis.biz
keywordsschulen, co, beton, tischtennistische
msapplication-TileColor#D83434
theme-color#D83434
msapplication-TileImagehttps://www.tischtennis.biz/out/tt/img/favicons/favicon_512x512.png
langde
og:site_namehttps://www.tischtennis.biz/
og:titleBeton Tischtennistische
og:descriptionBeton Tischtennisplatten für Schulen in großer Auswahl ✓ sparen Sie 22% ✓ 1A Qualität ✓ Top Bewertung ✓ versandkostenfrei ✓ jetzt kaufen bei Tischtennis.biz
og:typewebsite
og:imagehttps://www.tischtennis.biz/out/tt/img/basket.png
og:urlhttps://www.tischtennis.biz/
X-UA-CompatibleIE=edge
Content-Typetext/html; charset=UTF-8

Test up to 1.000 webpages of tischtennis.biz with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
Some words from the page title are not used within the pages content
Words from the H1 heading are not used in the page content.
This page contains 911 words. That's ok.
29.5% of the text are stop words.
The page contains a listing, which indicates a good text layout.
6 paragraphs were found on this page.
No placeholders texts or images were found.
There are no duplicates on the site.
The average number of words per sentence of 11.37 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 18 tags for this page.
Image SEO
(Somewhat important)
Alt text (alternative text) is correctly used on all found images.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/out/tt/img/logo_tischtennis-shop.pngLogo Tischtennis Shophier kommst du wieder auf die Startseite des Tischtennis Shops
/out/tt/img/logo_tischtennis-shop.pngTischtennis Shop Logo
/out/tt/img/spinner.gifBeton Tischtennistische
/out/tt/img/spinner.gifBetontischtennistisch TTpur® Standard
/out/tt/img/spinner.gifCornilleau Tischtennisplatte Park
/out/tt/img/spinner.gifGrundschul Beton Tischtennisplatte TTpur®
/out/tt/img/spinner.gifRunde Tischtennisplatte TTpur® aus Beton
/out/tt/img/spinner.gifCornilleau Ballast Tank für Park Tisch
/out/tt/img/spinner.gifCornilleau Anker Set für Park Tisch
/out/tt/img/spinner.gifCornilleau Pro 510 M
/out/tt/img/spinner.gifJoola Tischtennistisch City
/out/tt/img/spinner.gifSponeta 6-80e / 6-86e / 6-87 Active Outdoor
/out/tt/img/spinner.gifJoola Netz City

Page structure

H1 heading
(Critically important)
Beton Tischtennisplatten: extrem robust
The H1 heading is perfect.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 Beton Tischtennisplatten: extrem robust
H2 Vorteile von Betontischtennisplatten auf öffentlichen Plätzen
H2 Über Cookies auf dieser Website
H3 Alternativen z.B. Tischtennisplatten aus Stahl
H3 Können wir helfen?
Some internal links have dynamic parameters. All internal URLs, which are not marked as nofollow, should not contain dynamic parameters.
Some anchor texts are used more than once.
2 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
There are 1 external links on this page.

Found links on this page

LinkAttributesAnchor text
https://www.tischtennis.biz/Subdomain IMG-ALT Logo Tischtennis Shop
/index.php?cl=accountSubdomain Mein Konto
/index.php?cl=compareSubdomain Mein Artikelvergleich
/index.php?cl=account_noticelistSubdomain Mein Merkzettel
/index.php?cl=forgotpwdSubdomain ?
A-TITLE Passwort vergessen?
/index.php?cl=registerSubdomain Registrieren
A-TITLE Registrieren
/index.php?cl=forgotpwdSubdomain Passwort vergessen?
https://www.tischtennis.biz/Subdomain IMG-ALT Tischtennis Shop Logo
A-TITLE Startseite
https://www.tischtennis.biz/Subdomain Startseite
/beton-tischtennistische/Anchor Spieler
/beton-tischtennistische/Anchor Zurück Menü
/spielerbedarf/Subdomain Kategorieübersicht Spieler
/tischtennisbelaege/Subdomain Tischtennisbeläge
/tischtennishoelzer/Subdomain Tischtennishölzer
/kleber-cleaner/Subdomain Kleber&Cleaner
/wettkampf-tischtennisschlaeger/Subdomain Tischtennisschläger (kompl.)
/taschen-huellen/Subdomain Taschen&Hüllen
/textil/Subdomain Textil
/tischtennis-baelle/Subdomain Tischtennis Bälle
/tischtennisschuhe/Subdomain Tischtennisschuhe
/tischtennisspieler-diverse/Subdomain Diverse
/beton-tischtennistische/Anchor Vereine
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/vereinsbedarf/Subdomain Kategorieübersicht Vereine
/tischtennistische/Subdomain Tischtennistische
/vereinsbedarf-diverse/Subdomain Zubehör
/bekleidung/Subdomain Bekleidung
/tischtennisbaelle/Subdomain Tischtennisbälle
/tischtennisroboter/Subdomain Tischtennisroboter
/beton-tischtennistische/Anchor Hobby
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/hobby-tischtennis/Subdomain Kategorieübersicht Hobby
/outdoor-tischtennisplatten/Subdomain Outdoor Tischtennisplatten
/tischtennisplatten/Subdomain Indoor Tischtennisplatten
/auswahl-einer-tischtennisplatte/Subdomain Tischtennisplatte: Fragen zur Auswahl (Ratgeber)
/ersatzteile-tischtennisplatte/Subdomain Ersatzteile für Tischtennisplatten
/tischtennisnetze/Subdomain Tischtennisnetze
/zubehoer-tische/Subdomain Zubehör-Tische
/schlaeger-huellen/Subdomain Schlägerhüllen
/tischtennisschlaeger/Subdomain Tischtennisschläger
/hobby-tischtennis/tt-baelle/Subdomain TT-Bälle
/beton-tischtennistische/Anchor Schulen & Co
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/tischtennis-schule/Subdomain Kategorieübersicht Schulen & Co
/tischtennis-schule/tt-tische-...Subdomain TT-Tische für Innen
/beton-tischtennistische/Subdomain Beton Tischtennistische
/tischtennis-schlaeger-gross/Subdomain Tischtennis Schläger
/andere-sportarten/Subdomain andere Sportarten
/beton-tischtennistische/Anchor Training
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/training/Subdomain Kategorieübersicht Training
/training/billard/Subdomain Billard
/andere-sportarten/kicker/Subdomain Kicker
/training/teqball/Subdomain Teqball
/training/gesundheit/Subdomain Gesundheit
/headis/Subdomain Headis
/beton-tischtennistische/Anchor Angebote
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/angebote/Subdomain Kategorieübersicht Angebote
/angebote/angebot-des-monats/Subdomain Angebot des Monats
/angebote/neue-tischtennisarti...Subdomain Neue Tischtennisartikel im Shop
/angebote/kombi-angebote/Subdomain Kombi Angebote
/restposten/Subdomain Restposten
/belaege-hoelzer/Subdomain Beläge & Hölzer
/tischtennis-vereine/Subdomain für Vereine
/hobby/Subdomain Text duplicate Hobby
/beton-tischtennistische/Anchor vor Ort
/beton-tischtennistische/Anchor Text duplicate Zurück Menü
/laden/Subdomain Kategorieübersicht vor Ort
/ansprechpartner-bei-tischtenn...Subdomain Ansprechpartner bei Tischtennis pur
/ueber-uns/Subdomain Über uns
/laden/butterfly-store/Subdomain Butterfly-Store
/service-regional/Subdomain Service
/laden-oeffnungszeiten/Subdomain Laden&Öffnungszeiten
/laden/material-test/Subdomain Material-Test
/ttblog/Subdomain TT-Blog
https://www.tischtennis.biz/Subdomain Text duplicate Startseite
/spielerbedarf/Subdomain Text duplicate Spieler
/tischtennisbelaege/Subdomain Text duplicate Tischtennisbeläge
/tischtennishoelzer/Subdomain Text duplicate Tischtennishölzer
/kleber-cleaner/Subdomain Text duplicate Kleber&Cleaner
/wettkampf-tischtennisschlaeger/Subdomain Text duplicate Tischtennisschläger (kompl.)
/taschen-huellen/Subdomain Text duplicate Taschen&Hüllen
/textil/Subdomain Text duplicate Textil
/tischtennis-baelle/Subdomain Text duplicate Tischtennis Bälle
/tischtennisschuhe/Subdomain Text duplicate Tischtennisschuhe
/tischtennisspieler-diverse/Subdomain Text duplicate Diverse
/vereinsbedarf/Subdomain Text duplicate Vereine
/tischtennistische/Subdomain Text duplicate Tischtennistische
/vereinsbedarf-diverse/Subdomain Text duplicate Zubehör
/bekleidung/Subdomain Text duplicate Bekleidung
/tischtennisbaelle/Subdomain Text duplicate Tischtennisbälle
/tischtennisroboter/Subdomain Text duplicate Tischtennisroboter
/hobby-tischtennis/Subdomain Text duplicate Hobby
/outdoor-tischtennisplatten/Subdomain Text duplicate Outdoor Tischtennisplatten
/tischtennisplatten/Subdomain Text duplicate Indoor Tischtennisplatten
/auswahl-einer-tischtennisplatte/Subdomain Text duplicate Tischtennisplatte: Fragen zur Auswahl (Ratgeber)
/ersatzteile-tischtennisplatte/Subdomain Text duplicate Ersatzteile für Tischtennisplatten
/tischtennisnetze/Subdomain Text duplicate Tischtennisnetze
/zubehoer-tische/Subdomain Text duplicate Zubehör-Tische
/schlaeger-huellen/Subdomain Text duplicate Schlägerhüllen
/tischtennisschlaeger/Subdomain Text duplicate Tischtennisschläger
/hobby-tischtennis/tt-baelle/Subdomain Text duplicate TT-Bälle
/tischtennis-schule/Subdomain Text duplicate Schulen & Co
/tischtennis-schule/tt-tische-...Subdomain Text duplicate TT-Tische für Innen
/beton-tischtennistische/Subdomain Text duplicate Beton Tischtennistische
/tischtennis-schlaeger-gross/Subdomain Text duplicate Tischtennis Schläger
/andere-sportarten/Subdomain Text duplicate andere Sportarten
/training/Subdomain Text duplicate Training
/training/billard/Subdomain Text duplicate Billard
/andere-sportarten/kicker/Subdomain Text duplicate Kicker
/training/teqball/Subdomain Text duplicate Teqball
/training/gesundheit/Subdomain Text duplicate Gesundheit
/headis/Subdomain Text duplicate Headis
/angebote/Subdomain Text duplicate Angebote
/angebote/angebot-des-monats/Subdomain Text duplicate Angebot des Monats
/angebote/neue-tischtennisarti...Subdomain Text duplicate Neue Tischtennisartikel im Shop
/angebote/kombi-angebote/Subdomain Text duplicate Kombi Angebote
/restposten/Subdomain Text duplicate Restposten
/belaege-hoelzer/Subdomain Text duplicate Beläge & Hölzer
/tischtennis-vereine/Subdomain Text duplicate für Vereine
/hobby/Subdomain Text duplicate Hobby
/laden/Subdomain Text duplicate vor Ort
/ansprechpartner-bei-tischtenn...Subdomain Text duplicate Ansprechpartner bei Tischtennis pur
/ueber-uns/Subdomain Text duplicate Über uns
/laden/butterfly-store/Subdomain Text duplicate Butterfly-Store
/service-regional/Subdomain Text duplicate Service
/laden-oeffnungszeiten/Subdomain Text duplicate Laden&Öffnungszeiten
/laden/material-test/Subdomain Text duplicate Material-Test
/ttblog/Subdomain Text duplicate TT-Blog
/index.php?cl=basketNofollow Subdomain No Text
https://www.tischtennis.biz/Subdomain Text duplicate A-TITLE Startseite
/index.php?cl=accountSubdomain No Text
/index.php?cl=basketSubdomain No Text
/tischtennis-schule/Subdomain Text duplicate Schulen & Co
A-TITLE Schulen & Co
/beton-tischtennistische/Subdomain Text duplicate Beton Tischtennistische
A-TITLE Beton Tischtennistische
/beton-tischtennistische/beton...Subdomain IMG-ALT Betontischtennistisch TTpur® Standard
A-TITLE Betontischtennistisch TTpur® Standard
/beton-tischtennistische/beton...Subdomain Text duplicate Betontischtennistisch TTpur® Standard
A-TITLE Betontischtennistisch TTpur® Standard
/beton-tischtennistische/beton...Subdomain Mehr Informationen
/beton-tischtennistische/corni...Subdomain IMG-ALT Cornilleau Tischtennisplatte Park
A-TITLE Cornilleau Tischtennisplatte Park
/beton-tischtennistische/corni...Subdomain Text duplicate Cornilleau Tischtennisplatte Park
A-TITLE Cornilleau Tischtennisplatte Park
/beton-tischtennistische/corni...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/grund...Subdomain IMG-ALT Grundschul Beton Tischtennisplatte TTpur®
A-TITLE Grundschul Beton Tischtennisplatte TTpur®
/beton-tischtennistische/grund...Subdomain Text duplicate Grundschul Beton Tischtennisplatte TTpur®
A-TITLE Grundschul Beton Tischtennisplatte TTpur®
/beton-tischtennistische/grund...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/runde...Subdomain IMG-ALT Runde Tischtennisplatte TTpur® aus Beton
A-TITLE Runde Tischtennisplatte TTpur® aus Beton
/beton-tischtennistische/runde...Subdomain Text duplicate Runde Tischtennisplatte TTpur® aus Beton
A-TITLE Runde Tischtennisplatte TTpur® aus Beton
/beton-tischtennistische/runde...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/corni...Subdomain IMG-ALT Cornilleau Ballast Tank für Park Tisch
A-TITLE Cornilleau Ballast Tank für Park Tisch
/beton-tischtennistische/corni...Subdomain Text duplicate Cornilleau Ballast Tank für Park Tisch
A-TITLE Cornilleau Ballast Tank für Park Tisch
/beton-tischtennistische/corni...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/corni...Subdomain IMG-ALT Cornilleau Anker Set für Park Tisch
A-TITLE Cornilleau Anker Set für Park Tisch
/beton-tischtennistische/corni...Subdomain Text duplicate Cornilleau Anker Set für Park Tisch
A-TITLE Cornilleau Anker Set für Park Tisch
/beton-tischtennistische/corni...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/corni...Subdomain IMG-ALT Cornilleau Pro 510 M
A-TITLE Cornilleau Pro 510 M
/beton-tischtennistische/corni...Subdomain Text duplicate Cornilleau Pro 510 M
A-TITLE Cornilleau Pro 510 M
/beton-tischtennistische/corni...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/joola...Subdomain IMG-ALT Joola Tischtennistisch City
A-TITLE Joola Tischtennistisch City
/beton-tischtennistische/joola...Subdomain Text duplicate Joola Tischtennistisch City
A-TITLE Joola Tischtennistisch City
/beton-tischtennistische/joola...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/spone...Subdomain IMG-ALT Sponeta 6-80e / 6-86e / 6-87 Active Outdoor
A-TITLE Sponeta 6-80e / 6-86e / 6-87 Active Outdoor
/beton-tischtennistische/spone...Subdomain Text duplicate Sponeta 6-80e / 6-86e / 6-87 Active Outdoor
A-TITLE Sponeta 6-80e / 6-86e / 6-87 Active Outdoor
/beton-tischtennistische/spone...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/joola...Subdomain IMG-ALT Joola Netz City
A-TITLE Joola Netz City
/beton-tischtennistische/joola...Subdomain Text duplicate Joola Netz City
A-TITLE Joola Netz City
/beton-tischtennistische/joola...Subdomain Text duplicate Mehr Informationen
/index.php?cl=contactSubdomain Kontakt
/index.php?cl=basketSubdomain Warenkorb
/index.php?cl=accountSubdomain Konto
/index.php?cl=account_noticelistSubdomain Merkzettel
/partnerprogramm/Subdomain Partnerprogramm
/lexikon/Subdomain Lexikon
/index.php?cl=dgcookieconsento...Subdomain Cookie-Einstellungen
/impressum/Subdomain Impressum
https://www.tischtennis.biz/agb/Subdomain AGB
/datenschutz/Subdomain Datenschutz
/versand/Subdomain Versand
/widerrufsrecht/Subdomain Widerrufsrecht
/wie-bestellen/Subdomain Wie Bestellen ?
/index.php?cl=newsletterSubdomain Newsletter
/ttblog/Blog
/outdoor-tischtennisplatten/Text duplicate Outdoor Tischtennisplatten
/tischtennisschlaeger/Text duplicate Tischtennisschläger
/tischtennisbelaege/Text duplicate Tischtennisbeläge
/tischtennishoelzer/Text duplicate Tischtennishölzer
/versand/Subdomain Versandkosten
https://www.tischtennis-pur.de/New window External Subdomain Tischtennis pur e.K.
A-TITLE Tischtennis pur -- Tischtennis-News Forum Turniere
/index.php?cl=dgcookieconsento...Subdomain Einstellungen
/datenschutz/Subdomain Text duplicate Datenschutz
/impressum/Subdomain Text duplicate Impressum

Server configuration

HTTP redirects
(Critically important)
The checked page does not redirect to another URL.
HTTP header
(Important)
The X-powered header is sent within the response header. (unnecessary)
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time is slow (1.24 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
The file size of the HTML document is fine (90 kB).

HTTP Response Header

NameValue
dateFri, 27 Sep 2024 15:07:35 GMT
content-typetext/html; charset=UTF-8
x-powered-byPHP/7.4.33
set-cookie36 Characters
varyAccept-Encoding,User-Agent
cf-cache-statusBYPASS
report-to{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=HgGBGRDzh7zEgnbHCQUWYP6fvyondAbPkPpP8ZpLy6Yd9FpTg0v7VWUZc%2BqjcMFrWWWm5SD6XrKpinJ3P8q2h0XexhCA6CF6ewndP%2BZa64JxQrXJtDVM2%2FT4DBsgeXdRUJQOj%2Fo%3D"}],"group":"cf-nel","max_age":604800}
nel{"success_fraction":0,"report_to":"cf-nel","max_age":604800}
servercloudflare
cf-ray8c9c67733864d3b9-FRA
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Nice to have)
This website is not classified "for adult only".
This page has only a few links from other websites.
This page only has backlinks from 5 referring domains.
This page only has 801 backlinks.
This page only has few backlinks from 2 different ip addresses.
Facebook popularity
(Somewhat important)
The page has 0 shares and comments on Facebook.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

Sitemap: https://www.tischtennis.biz/sitemapindex.xml


User-agent: *
Disallow: /admin/
Disallow: /Core/
Disallow: /tmp/
Disallow: /views/
Disallow: /Setup/
Disallow: /log/
#
Disallow: /newsletter/
Disallow: /en/newsletter/
Disallow: /index.php?cl=newsletter
#
Disallow: /AGB/
Disallow: /en/Terms-and-Conditions/
#
Disallow: /warenkorb/
Disallow: /en/cart/
Disallow: /index.php?cl=basket
#
Disallow: /mein-konto/
Disallow: /en/my-account/
Disallow: /index.php?cl=account
#
Disallow: /mein-merkzettel/
Disallow: /en/my-wishlist/
Disallow: /index.php?cl=account_noticelist
#
Disallow: /mein-wunschzettel/
Disallow: /en/my-gift-registry/
Disallow: /index.php?cl=account_wishlist
#
Disallow: /konto-eroeffnen/
Disallow: /en/open-account/
Disallow: /index.php?cl=register
#
Disallow: /passwort-vergessen/
Disallow: /en/forgot-password/
Disallow: /index.php?cl=forgotpwd
#
Disallow: /index.php?cl=moredetails
#
Disallow: /index.php?cl=review
#
Disallow: /index.php?cl=search
#
Disallow: /EXCEPTION_LOG.txt
#
# wildcards at the end, because of some crawlers see it as errors
Disallow: /*?cl=newsletter
Disallow: /*&cl=newsletter
#
Disallow: /*?cl=basket
Disallow: /*&cl=basket
#
Disallow: /*?cl=account
Disallow: /*&cl=account
#
Disallow: /*?cl=account_noticelist
Disallow: /*&cl=account_noticelist
#
Disallow: /*?cl=account_wishlist
Disallow: /*&cl=account_wishlist
#
Disallow: /*?cl=register
Disallow: /*&cl=register
#
Disallow: /*?cl=forgotpwd
Disallow: /*&cl=forgotpwd
#
Disallow: /*?cl=moredetails
Disallow: /*&cl=moredetails
#
Disallow: /*?cl=review
Disallow: /*&cl=review
#
Disallow: /*?cl=search
Disallow: /*&cl=search
#
Disallow: /*&fnc=tobasket
Disallow: /*&fnc=tocomparelist
Disallow: /*&addcompare=
#
Disallow: /*/sid/
Disallow: /*?sid=
Disallow: /*&sid=
#
Disallow: /*?cur=
Disallow: /*&cur


# 09-2018 @https://www.deepcrawl.com/knowledge/best-practice/robots-txt-noindex-the-best-kept-secret-in-seo/
Noindex: /agb/
Noindex: /Impressum/
Noindex: /passwort-vergessen/
Noindex: /konto-eroeffnen/
Noindex: /wie-bestellen/
Noindex: /Widerrufsrecht/
Noindex: /Versand/
Noindex: /sicherheits-informationen/
Noindex: /zahlungsmoeglichkeiten/
Noindex: /links/
Noindex: /warenkorb/
Noindex: /mein-konto/
Noindex: /mein-merkzettel/
Noindex: /mein-wunschzettel/
Noindex: /wunschzettel/
Noindex: /kontakt/
Noindex: /artikelliste/
Noindex: /newsletter/

Similar sites

Search preview

www.tischtennis.biz › beton-tischtennistische
Beton Tischtennisplatten besonders günstig kaufen
Beton Tischtennisplatten für Schulen in großer Auswahl ✓ sparen Sie 22% ✓ 1A Qualität ✓ Top Bewertung ✓ versandkostenfrei ✓ jetzt kaufen bei Tischtennis.biz

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Beton92%Check
Beton Tischtennisplatte89%Check
Beton Tischtennisplatten87%Check
Tischtennisplatte86%Check
Tischtennisplatten82%Check
Tischtennis pur73%Check
Park Tisch73%Check
Tischtennis Shop71%Check
Tischtennisplatte Park66%Check
Tischtennisplatte TTpur66%Check
Show more keywords and terms

Test up to 1.000 webpages of tischtennis.biz with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions