Tchibo-coffeeservice.de - SEO Checker

Overview of the SEO Check
Meta information
83% 
Page quality
63% 
Page structure
100% 
Link structure
25% 
Server
54% 
External factors
100% 
SEO Score
Response time
2.57 s
File size
384.80 kB
Words
3000
Media files
115
Number of links
341 internal / 15 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
The length of the page title is perfect. (519 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
The meta description is too long: 1035 pixels from max. 1000 pixels. Optimize description
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.tchibo-coffeeservice.de/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de-de
Server location: Germany
The following language is defined by HTML: de-de
Alternate/Hreflang Links
(Somewhat important)
The alternate link to the page itself is missing.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
robotsindex, follow
generatorSilverStripe - http://silverstripe.org
descriptionFinden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
langde-de
Content-Typetext/html; charset=utf-8
Content-typetext/html; charset=utf-8
charsetutf-8

Test up to 1.000 webpages of tchibo-coffeeservice.de with our free plan!

Sign Up Free
No trial. It's just free!

Page quality

Content
(Critically important)
Words from the H1 heading are not used in the page content.
There are 2 text duplicates on this page:
  • Duplicate: Bis zu 8 Heißgetränke in zwei Größen Zubereitung mit Milchpulver M...
This page contains 3000 words. That's ok.
27.5% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
The page contains a listing, which indicates a good text layout.
46 paragraphs were found on this page.
No placeholders texts or images were found.
The average number of words per sentence of 13.52 words is good.
Frames
(Critically important)
This website does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
This website loads 27 javascript files. This may affect the load time negatively.
A viewport "width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 60 tags for this page.
Image SEO
(Somewhat important)
21 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/services/out/images/tcs_logo.svgtcs logologo tcs
/services/out/images/logo-ewh.pngewh logoewh logo
/services/out/images/tcs_logo_small.svgNo alt attribute provided
/services/out/images/logo-small.pngewh logoewh logo
...es/out/images/dummy_telephone_header.jpgNo alt attribute provided
...rogram/out/img/account_points_header.pngPOINTS
/services/out/images/lens0.pngNo alt attribute provided
/services/out/images/login_mobile.pngNo alt attribute provided
.../out/images/motiv-newsletter-inhalte.pngNo alt attribute provided
/services/out/images/spinner.svg02 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slider 1680x853 DESKTOP
/services/out/images/spinner.svg10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
...s/tchibo/images/dummys/icons/icon_05.jpgNo alt attribute provided
...s/tchibo/images/dummys/icons/icon_06.jpgNo alt attribute provided
...s/tchibo/images/dummys/icons/icon_01.jpgNo alt attribute provided
...s/tchibo/images/dummys/icons/icon_02.jpgNo alt attribute provided
...s/tchibo/images/dummys/icons/icon_03.jpgNo alt attribute provided
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgPiacetto Caffè Crema Tradizionale, 1.000gPiacetto Caffè Crema Tradizionale, 1.000g
/services/out/images/spinner.svgPfefferminzePfefferminze
...s/content-slider/kaffeevollautomaten.pngkaffeevollautomatenkaffeevollautomaten
...ent-slider/kaffeevollautomaten-hover.pngkaffeevollautomaten hoverkaffeevollautomaten hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
...ontent-slider/filterkaffeemaschinen2.pngfilterkaffeemaschinen2filterkaffeemaschinen2
...t-slider/filterkaffeemaschinen-hover.pngfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/assets/content-slider/kapselmaschinen.pngkapselmaschinenkapselmaschinen
...content-slider/kapselmaschinen-hover.pngkapselmaschinen hoverkapselmaschinen hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/assets/content-slider/siebtraeger.pngsiebtraegersiebtraeger
...ets/content-slider/siebtraeger-hover.pngsiebtraeger hoversiebtraeger hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/services/out/images/spinner.svgkaffeevollautomatenkaffeevollautomaten
/services/out/images/spinner.svgkaffeevollautomaten hoverkaffeevollautomaten hover
/services/out/images/spinner.svgfilterkaffeemaschinen2filterkaffeemaschinen2
/services/out/images/spinner.svgfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/services/out/images/spinner.svgkapselmaschinenkapselmaschinen
/services/out/images/spinner.svgkapselmaschinen hoverkapselmaschinen hover
/services/out/images/spinner.svgsiebtraegersiebtraeger
/services/out/images/spinner.svgsiebtraeger hoversiebtraeger hover
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgWMF 1100 SWMF 1100 S
/services/out/images/spinner.svgCoffea IntenseCoffea Intense
/services/out/images/spinner.svgCoffea Professional PlusCoffea Professional Plus
/services/out/images/spinner.svgJura WE6 Piano Black (ohne Milchfunktion)Jura WE6 Piano Black (ohne Milchfunktion)
/services/out/images/spinner.svgJura WE8 Dark Inox (mit Milchfunktion)Jura WE8 Dark Inox (mit Milchfunktion)
/services/out/images/spinner.svgMoccamaster KBG Select alu gebürstetMoccamaster KBG Select alu gebürstet
/services/out/images/spinner.svgKombi-Paket "Moccamaster KBG Feine Milde"Kombi-Paket "Moccamaster KBG Feine Milde"
/services/out/images/spinner.svgMoccamaster KBG Select schwarzMoccamaster KBG Select schwarz
/services/out/images/spinner.svgMoccamaster KBG Select pastell grünMoccamaster KBG Select pastell grün
/services/out/images/spinner.svgMoccamaster KBG Select gelbMoccamaster KBG Select gelb
/services/out/images/spinner.svgMoccamaster KBG matt schwarzMoccamaster KBG matt schwarz
/services/out/images/spinner.svgEasy ProfessionalEasy Professional
/services/out/images/spinner.svgTWIN KapselautomatTWIN Kapselautomat
/services/out/images/spinner.svgBarista KapselautomatBarista Kapselautomat
/services/out/images/spinner.svgCafissimo Latte ProfessionalCafissimo Latte Professional
/services/out/images/spinner.svgStarterpaket "Siebträger"Starterpaket "Siebträger"
/services/out/images/spinner.svgExpobar Office Leva EB61, 2 BoilerExpobar Office Leva EB61, 2 Boiler
/services/out/images/spinner.svgWasserenthärter PatroneWasserenthärter Patrone
/services/out/images/spinner.svgCarimali KICCOCarimali KICCO
/services/out/images/spinner.svgWMF EspressoWMF Espresso
/assets/content-slider/ganze-bohne.pngganze bohneganze bohne
...ets/content-slider/ganze-bohne-hover.pngganze bohne hoverganze bohne hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/assets/content-slider/muehle.pngmuehlemuehle
/assets/content-slider/muehle-hover.pngmuehle hovermuehle hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/assets/content-slider/kapseln.pngkapselnkapseln
/assets/content-slider/kapseln-hover.pngkapseln hoverkapseln hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/assets/content-slider/tee-tasse.pngtee tassetee tasse
/assets/content-slider/tee-tasse-hover.pngtee tasse hovertee tasse hover
/themes/tchibo/images/arrows_m8.pngNo alt attribute provided
/services/out/images/spinner.svgganze bohneganze bohne
/services/out/images/spinner.svgganze bohne hoverganze bohne hover
/services/out/images/spinner.svgmuehlemuehle
/services/out/images/spinner.svgmuehle hovermuehle hover
/services/out/images/spinner.svgkapselnkapseln
/services/out/images/spinner.svgkapseln hoverkapseln hover
/services/out/images/spinner.svgtee tassetee tasse
/services/out/images/spinner.svgtee tasse hovertee tasse hover
/services/out/images/spinner.svgProbierpaket Café Crème KLEINProbierpaket Café Crème KLEIN
/services/out/images/spinner.svgProbierpaket Café Crème GROSSProbierpaket Café Crème GROSS
/services/out/images/spinner.svgTchibo Café Crème Classique, 500gTchibo Café Crème Classique, 500g
/services/out/images/spinner.svgTchibo Café Crème Suisse, 500gTchibo Café Crème Suisse, 500g
/services/out/images/spinner.svgTchibo Espresso Speciale, 500gTchibo Espresso Speciale, 500g
/services/out/images/spinner.svgTchibo Espresso Classico, 500gTchibo Espresso Classico, 500g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 6x80gTchibo Café Gourmet mild, 6x80g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 500gTchibo Café Gourmet mild, 500g
/services/out/images/spinner.svgTchibo Café Gourmet Elegant, 6x90gTchibo Café Gourmet Elegant, 6x90g
/services/out/images/spinner.svgTchibo Café Gourmet elegant, 500gTchibo Café Gourmet elegant, 500g
/services/out/images/spinner.svgTchibo Café Classic mild, 6x70gTchibo Café Classic mild, 6x70g
/services/out/images/spinner.svgServicepaket Business Line "Tchibo"Servicepaket Business Line "Tchibo"
/services/out/images/spinner.svgPiacetto Caffè Crema Supremo, KapselnPiacetto Caffè Crema Supremo, Kapseln
/services/out/images/spinner.svgPiacetto Espresso Supremo, KapselnPiacetto Espresso Supremo, Kapseln
/services/out/images/spinner.svgKaffee kräftig, 10 KapselnKaffee kräftig, 10 Kapseln
/services/out/images/spinner.svgKaffee mild, 10 KapselnKaffee mild, 10 Kapseln
/services/out/images/spinner.svgCaffè Crema mild, 10 KapselnCaffè Crema mild, 10 Kapseln
/services/out/images/spinner.svgEspresso elegant, 10 KapselnEspresso elegant, 10 Kapseln
/services/out/images/spinner.svgPure Iced Tea Grüner Tee Zitrone IngwerPure Iced Tea Grüner Tee Zitrone Ingwer
/services/out/images/spinner.svgPure Iced Tea Früchtetee Himbeer HolunderblütePure Iced Tea Früchtetee Himbeer Holunderblüte
/services/out/images/spinner.svgPure Tea Selection - Klassik BioPure Tea Selection - Klassik Bio
/services/out/images/spinner.svgPure Tea Selection - Earl GreyPure Tea Selection - Earl Grey
/services/out/images/spinner.svgPure Tea Selection - DarjeelingPure Tea Selection - Darjeeling
/services/out/images/spinner.svgPure Tea Selection - WaldbeerePure Tea Selection - Waldbeere
/assets/icons/icon-check-000000.pngicon check 000000
/assets/icons/icon-sprechblase-000000.pngicon sprechblase 000000
...ets/icons/icon-taschenrechner-000000.pngicon taschenrechner 000000
/assets/icons/icon-teetasse.pngicon teetasse
/assets/icons/icon-lampe.pngicon lampe
/assets/icons/icon-person.pngicon person
/assets/icons/icon-baum.pngicon baum
/services/out/images/spinner.svgNo alt attribute provided
/services/out/images/spinner.svgNo alt attribute provided
...es/out/images/dummy_telephone_header.jpgNo alt attribute provided

Page structure

H1 heading
(Critically important)
Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
The H1 heading is perfect.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
H2 Systemlösungen für Ihren Kaffee-Ausschank
H2 Rundum-Versorgung für höchsten Genuss
H2 Tchibo Coffee Service – das Unternehmen
Baselink: https://www.tchibo-coffeeservice.de/
Some internal link anchor texts are too long.
Some internal links have dynamic parameters. All internal URLs, which are not marked as nofollow, should not contain dynamic parameters.
Some anchor texts are used more than once.
1 links don't have an anchor text.
The amount of internal links is ok.
There are 15 external links on this page.
LinkAttributesAnchor text
/IMG-ALT tcs logo
https://www.espressowarehouse.de/External IMG-ALT ewh logo
/No Text
https://www.espressowarehouse.de/External Text duplicate IMG-ALT ewh logo
/kundendienst-und-support/Kundenservice
/ihre-vorteile/Ihre Vorteile
/praemien/IMG-ALT POINTS
/DE
/Germany
https://www.tchibo-coffeeservi...External Austria
https://www.tchibo-coffeeservi...External Poland
https://www.tchibo-coffeeservi...External Czech Republic
http://www.tchibo-coffee.co.uk/External United Kingdom
https://www.tchibo-coffeeservi...External Worldwide
/Brutto
/shop/index.php?cl=oxubase&fnc...Netto
/Text duplicate Brutto
/shop/warenkorb/No Text
/shop/mein-konto/Login
/shop/kaffee/Kaffee
/shop/ganze-bohne/Ganze Bohne
/shop/mahlkaffee/Mahlkaffee
/shop/kapseln/Kapseln
/shop/instant/Instant
/shop/to-go-zubehoer/To Go Zubehör
/shop/kaffee-im-abo/Kaffee im Abo
/feine-milde/Feine Milde fürs Büro
/shop/milch-zucker/Milch, Zucker & Gebäck
/shop/fair-trade/Fair Trade
/kaffee-akademie/Kaffee-Akademie
/tchibo-kaffee/Tchibo
/shop/eduscho/Eduscho
/shop/piacetto-espresso/Piacetto
/davidoff-cafe/Davidoff
/shop/kaffeemaschinen/Kaffeemaschinen
/shop/kaffeevollautomaten/Kaffeevollautomaten
/shop/filterkaffeemaschinen/Filterkaffeemaschinen
/shop/kapselmaschinen/Kapselmaschinen
/shop/siebtraeger/Siebträger
/shop/maschinenfinder/Kaffeelösung planen
/shop/reinigung/Reinigung
/kaffeevollautomaten-mieten-fi...Mieten / Finanzieren
/filterkaffeemaschine-gratisFilterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebraucht-Angebote
/shop/kaffeemaschinenzubehoer/Kaffeemaschinenzubehör
/wasserspenderWasserspender
/shop/wmf-kaffeemaschinen/WMF
/shop/index.php?cl=alist&searc...Franke
/shop/moccamaster-kaffeemaschi...Moccamaster
/shop/jura-kaffeemaschinen/JURA
/shop/tee-mehr/Tee & mehr
/shop/tee/Tee
/shop/trinkschokolade/Trinkschokolade
/shop/milch-zucker/Text duplicate Milch, Zucker & Gebäck
/shop/geschirr-besteck/Geschirr & Besteck
/shop/to-go-zubehoer/Text duplicate To Go Zubehör
/shop/milchpulver-topping/Milchpulver & Topping
/shop/sirup-smoothies/Sirup
/wasserspender/Text duplicate Wasserspender
/pure-tea-selection/Pure Tea Selection
/shop/pure-fine-selection/Pure Fine Selection
/shop/davinci/DaVinci
/shop/spar-angebote/% Sale
/shop/angebote/?attrfilter[C21...Text duplicate Kaffeemaschinen
/shop/angebote/?attrfilter[C21...Text duplicate Kaffee
/shop/angebote/?attrfilter[C21...Text duplicate Tee & mehr
/shop/angebote/?attrfilter[C21...Restposten
/filterkaffeemaschine-gratisText duplicate Filterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebrauchtmaschinen-Angebote
/1-19-mitarbeiter/Büros 1-19 Mitarbeiter
/ueber-20-mitarbeiter/Büros 20 + Mitarbeiter
/hotel/Hotels
/gastronomie/Gastronomie
/baeckerei/Bäckereien
/shop/maschinenfinder/Text duplicate Kaffeelösung planen
/kaffeevollautomaten-mieten-fi...Vollautomat mieten / finanzieren
/filterkaffeemaschine-gratisText duplicate Filterkaffeemaschine GRATIS
/feine-milde/Text duplicate Feine Milde fürs Büro
/kaffee-akademie/Text duplicate Kaffee-Akademie
/inneneinrichtung/Einrichtungskonzepte
/wasserspenderText duplicate Wasserspender
https://www.tchibo2go.de/New window External Tchibo2Go-Komplettkonzept
/shop/kaffee-im-homeoffice/Fürs Homeoffice
/praemien/Text duplicate POINTS
/kontakt/Kontakt
/infos-anfordern/Infos anfragen
/kontakt/Text duplicate Kontakt
/shop/newsletter/Newsletter
/shop/bestellhistorie/1 Click Order
/shop/newsletter/Jetzt abonnieren
/kaffeevollautomaten-mieten-fi...IMG-ALT 02 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slider 1680x853 DESKTOP
/kaffeevollautomaten-mieten-fi...Kaffeevollautomat ab € 38 pro Monat mieten oder finanzieren Technischer Service vor Ort Flexible Vertragslaufzeiten Bis zu 25% Dauerrabatt auf Kaffee Jetzt i...
/filterkaffeemaschine-gratis/IMG-ALT 10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
/filterkaffeemaschine-gratis/Filterkaffeemaschine Gratis Inkl. 2 Pumpkannen Inkl. Austausch-Service Kaffee und Zubehör ab 7 Cent / Tasse Zum Angebot
/1-19-mitarbeiter/1-19 Mitarbeiter
/ueber-20-mitarbeiter/20 + Mitarbeiter
/gastronomie/Text duplicate Gastronomie
/hotel/Hotel
/baeckerei/Bäckerei
/shop/kaffeevollautomaten/Alle Kaffeevollautomaten anzeigen »
A-TITLE Alle Artikel
/shop/coffea-compact-oxid.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Versand
/shop/versand-zahlungsarten/Lieferdetails
/shop/coffea-compact-oxid.htmlZum Produkt
/shop/coffea-compact-oxid.htmlIn den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeevollautomaten/Nofollow Alle Artikel
/shop/kaffee/Alle Kaffees anzeigen »
A-TITLE Alle Artikel
/shop/piacetto-caffe-crema-tra...Piacetto Caffè Crema Tradizionale, 1.000g
IMG-ALT Piacetto Caffè Crema Tradizionale, 1.000g
A-TITLE Piacetto Caffè Crema Tradizionale, 1.000g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/piacetto-caffe-crema-tra...Text duplicate Zum Produkt
/shop/piacetto-caffe-crema-tra...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Nofollow Text duplicate Alle Artikel
/shop/tee/Alle Tees anzeigen »
A-TITLE Alle Artikel
/shop/nach-lieferant/tchibo/pf...Pfefferminze
IMG-ALT Pfefferminze
A-TITLE Pfefferminze
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/nach-lieferant/tchibo/pf...Text duplicate Zum Produkt
/shop/nach-lieferant/tchibo/pf...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee/Nofollow Text duplicate Alle Artikel
/shop/coffea-compact-oxid.htmlText duplicate Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/coffea-compact-oxid.htmlText duplicate Zum Produkt
/shop/coffea-compact-oxid.htmlText duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/wmf-1100-s.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT WMF 1100 S
IMG-ALT WMF 1100 S
A-TITLE WMF 1100 S
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/wmf-1100-s.htmlText duplicate Zum Produkt
/shop/wmf-1100-s.htmlText duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/coffea-intense.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Intense
IMG-ALT Coffea Intense
A-TITLE Coffea Intense
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/coffea-intense.htmlText duplicate Zum Produkt
/shop/coffea-intense.htmlText duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/nach-lieferant/tchibo/co...Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Professional Plus
IMG-ALT Coffea Professional Plus
A-TITLE Coffea Professional Plus
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/nach-lieferant/tchibo/co...Text duplicate Zum Produkt
/shop/nach-lieferant/tchibo/co...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/jura-we6-piano-black-ohn...Jura WE6 Piano Black (ohne Milchfunktion)
IMG-ALT Jura WE6 Piano Black (ohne Milchfunktion)
A-TITLE Jura WE6 Piano Black (ohne Milchfunktion)
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/jura-we6-piano-black-ohn...Text duplicate Zum Produkt
/shop/jura-we8-dark-inox-mit-m...Jura WE8 Dark Inox (mit Milchfunktion)
IMG-ALT Jura WE8 Dark Inox (mit Milchfunktion)
A-TITLE Jura WE8 Dark Inox (mit Milchfunktion)
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/jura-we8-dark-inox-mit-m...Text duplicate Zum Produkt
/shop/moccamaster-kbg-select-a...Moccamaster KBG Select alu gebürstet
IMG-ALT Moccamaster KBG Select alu gebürstet
A-TITLE Moccamaster KBG Select alu gebürstet
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/moccamaster-kbg-select-a...Text duplicate Zum Produkt
/shop/kombi-paket-moccamaster-...Kombi-Paket Kombi-Paket "Moccamaster KBG Feine Milde"
IMG-ALT Kombi-Paket "Moccamaster KBG Feine Milde"
A-TITLE Kombi-Paket "Moccamaster KBG Feine Milde"
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/kombi-paket-moccamaster-...Text duplicate Zum Produkt
/shop/kombi-paket-moccamaster-...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-s...Moccamaster KBG Select schwarz
IMG-ALT Moccamaster KBG Select schwarz
A-TITLE Moccamaster KBG Select schwarz
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/moccamaster-kbg-select-s...Text duplicate Zum Produkt
/shop/moccamaster-kbg-select-s...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-p...Moccamaster KBG Select pastell grün
IMG-ALT Moccamaster KBG Select pastell grün
A-TITLE Moccamaster KBG Select pastell grün
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/moccamaster-kbg-select-p...Text duplicate Zum Produkt
/shop/moccamaster-kbg-select-p...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-g...Moccamaster KBG Select gelb
IMG-ALT Moccamaster KBG Select gelb
A-TITLE Moccamaster KBG Select gelb
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/moccamaster-kbg-select-g...Text duplicate Zum Produkt
/shop/moccamaster-kbg-select-g...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-matt-sch...Moccamaster KBG matt schwarz
IMG-ALT Moccamaster KBG matt schwarz
A-TITLE Moccamaster KBG matt schwarz
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/moccamaster-kbg-matt-sch...Text duplicate Zum Produkt
/shop/moccamaster-kbg-matt-sch...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/easy-professional-oxid.html6 Probier-Kapseln gratis Easy Professional
IMG-ALT Easy Professional
A-TITLE Easy Professional
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/easy-professional-oxid.htmlText duplicate Zum Produkt
/shop/twin-kapselautomat.html6 Probier-Kapseln gratis TWIN Kapselautomat
IMG-ALT TWIN Kapselautomat
A-TITLE TWIN Kapselautomat
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/twin-kapselautomat.htmlText duplicate Zum Produkt
/shop/barista-kapselautomat.htmlProbierkapseln gratis Barista Kapselautomat
IMG-ALT Barista Kapselautomat
A-TITLE Barista Kapselautomat
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/barista-kapselautomat.htmlText duplicate Zum Produkt
/shop/cafissimo-latte-professi...Cafissimo Latte Professional
IMG-ALT Cafissimo Latte Professional
A-TITLE Cafissimo Latte Professional
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/cafissimo-latte-professi...Text duplicate Zum Produkt
/shop/starterpaket-siebtraeger...Sie sparen 150 € Starterpaket "Siebträger"
IMG-ALT Starterpaket "Siebträger"
A-TITLE Starterpaket "Siebträger"
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/starterpaket-siebtraeger...Text duplicate Zum Produkt
/shop/expobar-office-leva-eb61...Expobar Office Leva EB61, 2 Boiler
IMG-ALT Expobar Office Leva EB61, 2 Boiler
A-TITLE Expobar Office Leva EB61, 2 Boiler
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/expobar-office-leva-eb61...Text duplicate Zum Produkt
/shop/wasserenthaerter-patrone...Wasserenthärter Patrone
IMG-ALT Wasserenthärter Patrone
A-TITLE Wasserenthärter Patrone
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/wasserenthaerter-patrone...Text duplicate Zum Produkt
/shop/carimali-kicco.htmlCarimali KICCO
IMG-ALT Carimali KICCO
A-TITLE Carimali KICCO
/shop/carimali-kicco.htmlText duplicate Zum Produkt
/maschinen-kontakt/?mk_article...Anfrage
A-TITLE Kontakt
/shop/wmf-espresso.htmlWMF Espresso
IMG-ALT WMF Espresso
A-TITLE WMF Espresso
/shop/wmf-espresso.htmlText duplicate Zum Produkt
/maschinen-kontakt/?mk_article...Text duplicate Anfrage
A-TITLE Kontakt
/shop/probierpaket-cafe-creme-...Sie sparen 10% Probierpaket Café Crème KLEIN
IMG-ALT Probierpaket Café Crème KLEIN
A-TITLE Probierpaket Café Crème KLEIN
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/probierpaket-cafe-creme-...Text duplicate Zum Produkt
/shop/probierpaket-cafe-creme-...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/probierpaket-cafe-creme-...Sie sparen 25% Probierpaket Café Crème GROSS
IMG-ALT Probierpaket Café Crème GROSS
A-TITLE Probierpaket Café Crème GROSS
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/probierpaket-cafe-creme-...Text duplicate Zum Produkt
/shop/probierpaket-cafe-creme-...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-creme-classi...Tchibo Café Crème Classique, 500g
IMG-ALT Tchibo Café Crème Classique, 500g
A-TITLE Tchibo Café Crème Classique, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-creme-classi...Text duplicate Zum Produkt
/shop/tchibo-cafe-creme-classi...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-creme-suisse...Tchibo Café Crème Suisse, 500g
IMG-ALT Tchibo Café Crème Suisse, 500g
A-TITLE Tchibo Café Crème Suisse, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-creme-suisse...Text duplicate Zum Produkt
/shop/tchibo-cafe-creme-suisse...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-espresso-speciale...Tchibo Espresso Speciale, 500g
IMG-ALT Tchibo Espresso Speciale, 500g
A-TITLE Tchibo Espresso Speciale, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-espresso-speciale...Text duplicate Zum Produkt
/shop/tchibo-espresso-speciale...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-espresso-classico...Tchibo Espresso Classico, 500g
IMG-ALT Tchibo Espresso Classico, 500g
A-TITLE Tchibo Espresso Classico, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-espresso-classico...Text duplicate Zum Produkt
/shop/tchibo-espresso-classico...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-mild...Tchibo Café Gourmet mild, 6x80g
IMG-ALT Tchibo Café Gourmet mild, 6x80g
A-TITLE Tchibo Café Gourmet mild, 6x80g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-gourmet-mild...Text duplicate Zum Produkt
/shop/tchibo-cafe-gourmet-mild...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-mild...Tchibo Café Gourmet mild, 500g
IMG-ALT Tchibo Café Gourmet mild, 500g
A-TITLE Tchibo Café Gourmet mild, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-gourmet-mild...Text duplicate Zum Produkt
/shop/tchibo-cafe-gourmet-mild...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-eleg...Tchibo Café Gourmet Elegant, 6x90g
IMG-ALT Tchibo Café Gourmet Elegant, 6x90g
A-TITLE Tchibo Café Gourmet Elegant, 6x90g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-gourmet-eleg...Text duplicate Zum Produkt
/shop/tchibo-cafe-gourmet-eleg...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-eleg...Tchibo Café Gourmet elegant, 500g
IMG-ALT Tchibo Café Gourmet elegant, 500g
A-TITLE Tchibo Café Gourmet elegant, 500g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-gourmet-eleg...Text duplicate Zum Produkt
/shop/tchibo-cafe-gourmet-eleg...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-classic-mild...Tchibo Café Classic mild, 6x70g
IMG-ALT Tchibo Café Classic mild, 6x70g
A-TITLE Tchibo Café Classic mild, 6x70g
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/tchibo-cafe-classic-mild...Text duplicate Zum Produkt
/shop/tchibo-cafe-classic-mild...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/servicepaket-business-li...Sie sparen 42 € Servicepaket Business Line "Tchibo"
IMG-ALT Servicepaket Business Line "Tchibo"
A-TITLE Servicepaket Business Line "Tchibo"
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/servicepaket-business-li...Text duplicate Zum Produkt
/shop/piacetto-caffe-crema-sup...Piacetto Caffè Crema Supremo, Kapseln
IMG-ALT Piacetto Caffè Crema Supremo, Kapseln
A-TITLE Piacetto Caffè Crema Supremo, Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/piacetto-caffe-crema-sup...Text duplicate Zum Produkt
/shop/piacetto-espresso-suprem...Piacetto Espresso Supremo, Kapseln
IMG-ALT Piacetto Espresso Supremo, Kapseln
A-TITLE Piacetto Espresso Supremo, Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/piacetto-espresso-suprem...Text duplicate Zum Produkt
/shop/piacetto-espresso-suprem...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee-kraeftig-10-kapse...Kaffee kräftig, 10 Kapseln
IMG-ALT Kaffee kräftig, 10 Kapseln
A-TITLE Kaffee kräftig, 10 Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/kaffee-kraeftig-10-kapse...Text duplicate Zum Produkt
/shop/kaffee-kraeftig-10-kapse...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee-mild-10-kapseln.htmlKaffee mild, 10 Kapseln
IMG-ALT Kaffee mild, 10 Kapseln
A-TITLE Kaffee mild, 10 Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/kaffee-mild-10-kapseln.htmlText duplicate Zum Produkt
/shop/kaffee-mild-10-kapseln.h...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/caffe-crema-mild-10-kaps...Caffè Crema mild, 10 Kapseln
IMG-ALT Caffè Crema mild, 10 Kapseln
A-TITLE Caffè Crema mild, 10 Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/caffe-crema-mild-10-kaps...Text duplicate Zum Produkt
/shop/caffe-crema-mild-10-kaps...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/espresso-elegant-10-kaps...Espresso elegant, 10 Kapseln
IMG-ALT Espresso elegant, 10 Kapseln
A-TITLE Espresso elegant, 10 Kapseln
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/espresso-elegant-10-kaps...Text duplicate Zum Produkt
/shop/espresso-elegant-10-kaps...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-iced-tea-gruener-te...Sie sparen 20 % Pure Iced Tea Grüner Tee Zitrone Ingwer
IMG-ALT Pure Iced Tea Grüner Tee Zitrone Ingwer
A-TITLE Pure Iced Tea Grüner Tee Zitrone Ingwer
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-iced-tea-gruener-te...Text duplicate Zum Produkt
/shop/pure-iced-tea-gruener-te...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-iced-tea-fruechtete...Sie sparen 20 % Pure Iced Tea Früchtetee Himbeer Holunderblüte
IMG-ALT Pure Iced Tea Früchtetee Himbeer Holunderblüte
A-TITLE Pure Iced Tea Früchtetee Himbeer Holunderblüte
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-iced-tea-fruechtete...Text duplicate Zum Produkt
/shop/pure-iced-tea-fruechtete...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-klass...Pure Tea Selection - Klassik Bio
IMG-ALT Pure Tea Selection - Klassik Bio
A-TITLE Pure Tea Selection - Klassik Bio
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-tea-selection-klass...Text duplicate Zum Produkt
/shop/pure-tea-selection-klass...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-earl-...Pure Tea Selection - Earl Grey
IMG-ALT Pure Tea Selection - Earl Grey
A-TITLE Pure Tea Selection - Earl Grey
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-tea-selection-earl-...Text duplicate Zum Produkt
/shop/pure-tea-selection-earl-...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-darje...Pure Tea Selection - Darjeeling
IMG-ALT Pure Tea Selection - Darjeeling
A-TITLE Pure Tea Selection - Darjeeling
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-tea-selection-darje...Text duplicate Zum Produkt
/shop/pure-tea-selection-darje...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-waldb...Pure Tea Selection - Waldbeere
IMG-ALT Pure Tea Selection - Waldbeere
A-TITLE Pure Tea Selection - Waldbeere
/shop/versand-zahlungsarten/Text duplicate Versand
/shop/versand-zahlungsarten/Text duplicate Lieferdetails
/shop/pure-tea-selection-waldb...Text duplicate Zum Produkt
/shop/pure-tea-selection-waldb...Text duplicate In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Kaffeespezialitäten
/shop/kaffeevollautomaten/Text duplicate Kaffeevollautomaten
/shop/filterkaffeemaschinen/Text duplicate Filterkaffeemaschinen
/shop/tee-mehr/Kaffee- und Teeprodukten
/kundendienst-und-supportServicekonzepte
/shop/maschinenfinder/optimal für Sie geeigneten Maschine
/ihre-vorteile/Text duplicate Ihre Vorteile
/kundendienst-und-support/Text duplicate Kundenservice
/kontakt/Text duplicate Kontakt
/infos-anfordern/Text duplicate Infos anfragen
/shop/agb/AGB
/shop/versand-zahlungsarten/Lieferung & Zahlung
/shop/widerrufsrecht/Widerrufsrecht
/shop/out/zoxidflat/media/Tchi...Widerrufsformular
/shop/datenschutz/Datenschutz
/shop/impressum/Impressum
/unternehmen/Unternehmen
http://karriere.tchibo-coffees...External Subdomain Karriere
/faqsFAQ
/Text duplicate DE
/Text duplicate Germany
https://www.tchibo-coffeeservi...External Text duplicate Austria
https://www.tchibo-coffeeservi...External Text duplicate Poland
https://www.tchibo-coffeeservi...External Text duplicate Czech Republic
http://www.tchibo-coffee.co.uk/External Text duplicate United Kingdom
https://www.tchibo-coffeeservi...External Text duplicate Worldwide
https://www.tchibo.de/External Tchibo.de

Server configuration

HTTP redirects
(Critically important)
This website redirects to "https://www.tchibo-coffeeservice.de/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
This website uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time is very slow (2.57 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
This website loads 14 CSS files. This may affect the page load time negatively.
This website loads 27 javascript files. This may affect the load time negatively.
The file size of the HTML document is fine (385 kB).

HTTP Response Header

NameValue
servernginx
dateSat, 31 Oct 2020 23:26:30 GMT
content-typetext/html; charset=utf-8
content-length31954
varyAccept-Encoding
set-cookie54 Characters
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-cache, no-store, must-revalidate
pragmano-cache
x-dynamiccachemiss at Sun, 01 Nov 2020 00:26:28 +0100
last-modifiedWed, 22 Jul 2020 07:41:53 GMT
content-encodinggzip
x-sc-app10.3.120.11:80
x-sc-lb10.3.120.9
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Critically important)
This website is not classified "for adult only".
This website is not listed on the Shallalist.
This website has excellent links from other websites.
This website has backlinks from 354 referring domains.
This website has 15,910 backlinks.
This website has backlinks from 312 different ip addresses.
Facebook popularity
(Somewhat important)
This website has social activity like shares, comments or likes on facebook.
Listed on Webwiki
(Nice to have)
This website is listed on Webwiki.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

# For all robots
User-agent: *
Disallow: *searchparam*
Disallow: *cnid*
Disallow: *listtype*
Disallow: *ldtype*
Disallow: *force_sid*
Disallow: *addcompare*
Noindex: *searchparam*
Noindex: *cnid*
Noindex: *listtype*
Noindex: *ldtype*
Noindex: *force_sid*
Noindex: *addcompare*
Sitemap: https://www.tchibo-coffeeservice.de/shop/sitemaps/sitemap-index.xml
Disallow: /tchibo-smartcoffee/tchibo-smartcoffee-formular/

Facebook popularity

Shares / Likes / Comments
625

Only the data for the given URL is shown. We cannot determine the social actions for a linked fan page.

Search preview

www.tchibo-coffeeservice.de
Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Kaffee83%Check
Service82%Check
Tchibo82%Check
Tchibo Coffee Service81%Check
Kaffee Maschinen75%Check
Kaffee und Tee65%Check
Kaffeemaschinen63%Check
Bio Kaffee62%Check
Tchibo Espresso61%Check
Tassen Kaffee60%Check

Test up to 1.000 webpages of tchibo-coffeeservice.de with our free plan!

Sign Up Free
No trial. It's just free!