Übersicht der SEO Analyse
Metaangaben
100% 
Seitenqualität
86% 
Seitenstruktur
79% 
Verlinkung
75% 
Server
100% 
Externe Faktoren
100% 
SEO Score
Antwortzeit
0,13 s
Dateigröße
401,40 kB
Wörter
1385
Medien
64
Anzahl Links
110 Intern / 5 Extern

To-do Liste mit SEO Optimierungen

Meta-Angaben im HTML

Titel
(Extrem wichtig)
Die einfach gute Newsletter-Software: rapidmail
Die Länge des Titels ist optimal. (427 Pixel von maximal 580 Pixel Länge)
Es gibt keine Wortwiederholungen im Titel.
Meta-Description
(Extrem wichtig)
Das DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
Die Meta-Description hat eine optimale Länge. (909 Pixel von maximal 1000 Pixel Länge)
Crawlbarkeit
(Extrem wichtig)
Es gibt keine Probleme beim Zugriff auf die Webseite.
Canonical Link
(Wichtig)
https://www.rapidmail.de/
Die Seite hat einen korrekten Canonical Link.
Sprache
(Wenig wichtig)
Im Text erkannte Sprache: de
Im HTML angegebene Sprache: de
Serverstandort: Vereinigte Staaten von Amerika
Die Sprache wird im HTML Code wie folgt angegeben: de
Alternate/Hreflang Links
(Wenig wichtig)
Die angegebenen Alternate Links sind fehlerfrei.
Weitere Metatags
(Wenig wichtig)
Es gibt keinen rel next Meta Tag auf der Seite.
Es gibt keinen rel prev Meta Tag auf der Seite.
Domain
(Wenig wichtig)
Die Domain ist keine Subdomain.
Die Länge der Domain ist gut.
Die Domain enthält keine Umlaute.
Seiten URL
(Wenig wichtig)
In der URL wurden keine Parameter entdeckt.
In der URL wurde keine Session ID entdeckt.
Die URL hat nicht zu viele Unterverzeichnisse.
Zeichensatzkodierung
(Wenig wichtig)
Die Angaben zur Zeichensatzkodierung (UTF-8) sind fehlerfrei.
Doctype
(Nice to have)
Die Doctype Angabe HTML 5 ist korrekt angegeben.
Die Doctype Angabe befindet sich an erster Stelle im HTML-Code.
Favicon
(Nice to have)
Das Favoriten Icon (Favicon) ist korrekt verlinkt.

Meta Tags

NameWert
apple-mobile-web-app-titlerapidmail - DE
viewportwidth=device-width, initial-scale=1.0, maximum-scale=2.0
robotsindex, follow
descriptionDas DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
theme-color#e9edf2
google-site-verificationn7Q1LVmSVbxGU5QhFL2eAwx5O0V1zCJ6PL7yRXc9H_U
langde
og:localede_DE
og:site_namerapidmail.de
og:typewebsite
og:urlhttps://www.rapidmail.de/
og:imagehttps://www.rapidmail.de/images/assets/rapidmail_256x256.png
og:titleDie einfach gute Newsletter-Software: rapidmail
og:descriptionDas DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
charsetutf-8

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von rapidmail.de!

Kostenlos Testen
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Seitenqualität

Inhalt
(Extrem wichtig)
Der Inhalt ist mit 1385 Wörtern in Ordnung.
Der Text besteht zu 39.6% aus Füllwörtern.
Worte aus dem Titel werden im Text wiederholt.
Wörter aus der H1 Überschrift werden im Text der Seite verwendet.
Im Text befindet sich eine Aufzählung, dies deutet auf eine gute Textstruktur hin.
Es wurden 26 Fließtextblöcke auf der Seite gefunden.
Der Text auf der Seite ist optimal.
Es wurden keine Platzhalter Texte bzw. Bilder gefunden.
Es befinden sich keine Duplikate auf der Seite.
Die durchschnittliche Satzlänge ist mit 11.5 Wörtern gut.
Frames
(Extrem wichtig)
Die Seite hat kein Frameset.
Mobile
(Wenig wichtig)
Der angegebene Viewport (width=device-width, initial-scale=1.0, maximum-scale=2.0) ist korrekt.
Mindestens ein Apple-Touch Icon ist definiert.
Bold- und Strongtags
(Wenig wichtig)
Einige Tags werden wiederholt. z.B.: 4,8
Bilder Optimierung
(Wenig wichtig)
Bei 31 Bildern fehlt das Alt-Attribut. Der Inhalt von Alt-Attributen wird von Suchmaschinen auch als Text gewertet und ist wichtig für die Bildersuche.
Soziale Vernetzung
(Nice to have)
Es befinden sich wenige Social-Sharing Möglichkeiten auf der Seite. Mit Plugins zum Teilen kann die Reichweite der Seite in sozialen Netzwerken erhöht werden.
Zusätzliches Markup
(Nice to have)
Es wurde kein zusätzliches Markup gefunden.
HTTPS
(Wenig wichtig)
Die Seite verwendet HTTPS um Daten sicher zu übertragen.
Alle eingebundenen Dateien werden ebenfalls über HTTPS ausgeliefert.

Medienliste

URLALT-AttributeTitel
/images/main/logo-positive.svgrapidmail
...s/main/ui/templates/template-15--320.pngrapidmail Newsletter-Vorlage
/images/main/ui/penguin-trophy.svgKein ALT-Attribut angegeben
/images/main/ui/penguin-reading.svgKein ALT-Attribut angegeben
...e/thumbnail-ebook-einsteiger-v2--320.pngE-Book - E-Mail-Marketing für Einsteiger:innen
/images/main/ui/lifebelt.svgKein ALT-Attribut angegeben
/images/main/ui/laptop-video.pngKein ALT-Attribut angegeben
/images/main/features/mailing-editor.pngEinblick in die rapidmail Newsletter-Software
/images/main/features/reports-devices.pngKein ALT-Attribut angegeben
/images/main/features/reports-opens.pngKein ALT-Attribut angegeben
/images/main/customer/companies.svgCHECK24 / Hanse Merkur / Volkswagen / Deutsche Umweltstiftung / Katjes
/images/main/trust/omr_lead_24q2.svgOMR Reviews - Leader - E-Mail Marketing
/images/main/trust/omr_tr_24q2.svgOMR Reviews - Top Rated - E-Mail Marketing
/images/main/trust/omr_reviews_24q2_2.pngOMR Reviews
/images/main/trust/trustpilot__logo.svgTrustpilot
/images/main/trust/trustpilot__stars-5.svgTrustpilot Bewertung
/images/main/ui/support-headset.svgKein ALT-Attribut angegeben
/images/main/team/fabian--192x120.jpgKein ALT-Attribut angegeben
/images/main/team/markus--192x120.jpgKein ALT-Attribut angegeben
/images/main/team/frank--192x120.jpgKein ALT-Attribut angegeben
/images/main/team/lea--192x120.jpgKein ALT-Attribut angegeben
/images/main/team/tom--192x120.jpgKein ALT-Attribut angegeben
/images/main/ui/bulb.svgKein ALT-Attribut angegeben
...s/main/features/drag-and-drop-editor.pngrapidmail Drag-and-Drop Newsletter-Editor für eine intuitive Mailing-Gestaltung
/images/main/ui/arrow-4-accent.svgKein ALT-Attribut angegeben
...res/transaktionsmails-zustellbarkeit.svgKein ALT-Attribut angegeben
/images/main/ui/arrow-4-accent.svgKein ALT-Attribut angegeben
...eatures/empfaengeraktivitaet-tracken.pngrapidmail Newsletter-Statistik zum einfachen Messen des Mailing-Erfolgs
/images/main/ui/arrow-4-accent.svgKein ALT-Attribut angegeben
...konforme-verwaltung-empfaengerlisten.pngÜbersicht der in rapidmail angelegten Newsletter-Empfängerlisten
/images/main/ui/armadillo-dsgvo.svgKein ALT-Attribut angegeben
/images/main/ui/arrow-4-accent.svgKein ALT-Attribut angegeben
/images/main/features/1klick-url.svg1-Klick-Design URL eingeben
...ges/main/features/formular-anmeldung.pngKein ALT-Attribut angegeben
...eatures/formular-anmeldung-gebrandet.pngAnsprechendes Newsletter-Anmeldeformular im eigenen Unternehmensdesign
/images/main/ui/arrow-4-accent.svgKein ALT-Attribut angegeben
/images/main/ui/flamingo.svgKein ALT-Attribut angegeben
...s/main/ui/templates/template-10--320.pngrapidmail Newsletter-Vorlage für Unternehmen
...main/features/1klick-template-before.pngrapidmail Newsletter-Vorlage für Online-Shops
.../main/features/1klick-template-after.pngrapidmail Newsletter-Vorlage für Online-Shops
/images/main/ui/1-klick-visual.pngKein ALT-Attribut angegeben
...s/main/ui/templates/template-02--320.pngrapidmail Newsletter-Vorlage für Weihnachten
...s/main/ui/templates/template-15--320.pngrapidmail Newsletter-Vorlage für Unternehmen
...s/main/ui/templates/template-11--320.pngrapidmail Newsletter-Vorlage für Online-Shops
...s/main/ui/templates/template-16--320.pngrapidmail Newsletter-Vorlage für Ostern
...s/main/ui/templates/template-14--320.pngrapidmail Newsletter-Vorlage für Gastronomie
...s/main/ui/templates/template-13--320.pngrapidmail Newsletter-Vorlage für Online-Shops
...s/main/ui/templates/template-03--320.pngrapidmail Newsletter-Vorlage für Automobil
/images/main/ui/awards-customer.pngKein ALT-Attribut angegeben
/images/main/ui/trophy.svgKein ALT-Attribut angegeben
/images/main/trust/omr_lead_24q2.svgOMR Reviews - Leader - E-Mail Marketing
/images/main/trust/omr_reviews_24q2_2.pngOMR Reviews
/images/main/trust/omr_tr_24q2.svgOMR Reviews - Top Rated - E-Mail Marketing
/images/main/trust/trustpilot__logo.svgTrustpilot
/images/main/trust/trustpilot__stars-5.svgTrustpilot Bewertung
/images/main/trust/omr-stars-5.svg5 Sterne: hervorragend
/images/main/customer/companies-dark.svgCHECK24 / Hanse Merkur / Volkswagen / Deutsche Umweltstiftung / Katjes
/images/main/ui/bee-yellow-glasses-2.svgKein ALT-Attribut angegeben
/images/main/ui/speech-bubble-white.svgKein ALT-Attribut angegeben
.../sites/3/2019/12/guide-start-768x384.jpgKein ALT-Attribut angegeben
...nes-Email-Template-erstellen-768x384.jpgKein ALT-Attribut angegeben
...letter-im-Unternehmensdesign-768x384.pngKein ALT-Attribut angegeben
/images/main/ui/book-bulb.svgKein ALT-Attribut angegeben
/images/main/trust/seals.svgDSGVO-konform / Serverstandort Deutschland / Externer Datenschutzbeauftragter

Seitenstruktur

H1 Überschrift
(Extrem wichtig)
Professionelles E-Mail-Marketing kann jeder – mit rapidmail.
Die H1-Überschrift ist perfekt.
Überschriften
(Wichtig)
Es befinden sich 35 Überschriften auf der Seite. Die Anzahl der Überschriften sollte in einem besseren Verhältnis zum Text stehen.

Überschriftenstruktur

Überschriften HierarchieInhalt
H1 Professionelles E-Mail-Marketing kann jeder – mit rapidmail.
H2 Einfach gute Newsletter-Software
H2 Kostenloser Support Für alle Kunden, für immer!
H2 Wie funktioniert erfolgreiches E-Mail-Marketing?
H2 Über 250 kostenlose Newsletter-Vorlagen
H2 Ausgezeichnet
H2 Das Newsletter-Tool für alle
H2 Unsere Newsletter-Tipps & -Tricks
H2 FAQs zum rapidmail Newsletter-Tool
H3 Geliebt von über 200.000 Unternehmen
H3 Bestbewertet
H3 Newsletter gestalten wie ein Profi
H3 Flexibel und zuverlässig versenden
H3 Zielgruppen verstehen und Newsletter optimieren
H3 Newsletter-Kontakte einfach verwalten
H3 Einfach Newsletter-Anmeldungen gewinnen
H3 E-Commerce
H3 Unternehmen
H3 Agenturen
H3 Vereine
H3 Selbstständige
H3 Den ersten Newsletter erstellen und versenden: So gelingt’s
H3 Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
H3 Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
H3 Was ist rapidmail?
H3 Welche Funktionen bietet rapidmail?
H3 Über welche Schnittstellen verfügt rapidmail?
H3 Was unterscheidet rapidmail von anderen Newsletter-Tools?
H3 Wie benutzerfreundlich ist rapidmail?
H3 Wie sicher sind meine Daten bei rapidmail?
H3 Welche Tarife gibt es bei rapidmail?
H3 Kann man rapidmail kostenlos testen?
H3 Welchen Kundenservice bietet rapidmail?
H3 Welches Newsletter-Tool passt zu mir?
H4 Der rapidmail-Newsletter
Einige der Linktexte der internen Links sind zu lang.
Einige der Linktexte wiederholen sich.
Die Anzahl an internen Links ist ok.
Alle internen Links haben keine dynamischen Parameter.
Es befinden sich 5 externe Links auf der Seite.
LinkAttributeLinktext
https://www.rapidmail.de/IMG-ALT rapidmail
A-TITLE rapidmail - Newsletter Software
/funktionen-newsletter-erstellenNewsletter gestalten Gestalten Sie einfach schöne Newsletter.
/funktionen-newsletter-versendenNewsletter versenden Versenden Sie E-Mails flexibel und zuverlässig.
/funktionen-newsletter-reportingNewsletter auswerten Verstehen Sie besser, welche Inhalte gut ankommen.
/funktionen-kontakte-verwaltenKontakte verwalten Behalten Sie stets den Überblick über Ihre Newsletter-Kontakte.
/funktionen-kontakte-gewinnenKontakte gewinnen Finden Sie DSGVO-konform neue Abonnent:innen.
/funktionen-transaktionsmails-...Transaktionsmails versenden Versenden Sie zuverlässig SMTP-Mails.
/funktionen-plugins-integrationenShop-Integrationen Verbinden Sie Ihr Shopsystem einfach mit rapidmail.
/newsletter-funktionenAlle Funktionen
/kostenlose-newsletter-vorlagenNewsletter-Vorlagen Über 250 kostenlose Vorlagen und Design-Templates. Einfach anpassen und los. Alle Newsletter-Vorlagen
IMG-ALT rapidmail Newsletter-Vorlage
A-TITLE Kostenlose Newsletter-Vorlagen
/preise-newsletterversandPreise
A-TITLE Das kostet der Newsletter-Versand
/warum-rapidmail-referenzenrapidmail ist ausgezeichnet – mehrfach! Diese Erfahrungen machen über 200.000 Kund:innen mit unserer bestbewerteten Software. Warum rapidmail?
https://www.rapidmail.de/supportKostenloser Support Unsere Support-Enthusiast:innen helfen Ihnen bei allen Fragen.
/dsgvo-konformes-email-marketingMaximaler Datenschutz Unsere Newsletter-Software ist zu 100 % DSGVO-konform.
/maximale-zustellbarkeit-fuer-...Exzellente Zustellbarkeit Wir bringen Ihre Newsletter zuverlässig ins Ziel.
/ueber-rapidmailÜber rapidmail Lernen Sie die Gesichter hinter den rapidmail-Kulissen kennen.
/smarte-software-fuer-ecommerc...E-Commerce Steigern Sie Ihren Shop-Umsatz durch gezielte Produkt-Newsletter.
/effektives-newsletter-marketi...Unternehmen Erweitern Sie Ihren Kundenstamm durch personalisierte Mailings.
/smartes-newsletter-tool-fuer-...Agenturen Setzen Sie Kampagnen für Kund:innen einfach und professionell um.
/schnell-und-einfach-newslette...Vereine Halten Sie Mitglieder und Sponsor:innen kostengünstig auf dem Laufenden.
/effizientes-email-marketing-f...Selbstständige Gewinnen Sie nachhaltig neue Kund:innen für Ihr Unternehmen.
https://www.rapidmail.de/blograpidmail Blog Hilfreiche Tipps, kreative Ideen und die neuesten Trends: Alles, was Sie für erfolgreiche Newsletter brauchen. Zum Blog
/newsletter-guidesNewsletter-Guides Leicht verständliche Schritt-für-Schritt-Anleitungen.
/ebooks-und-downloadsKostenlose Downloads E-Books, Checklisten, Textvorlagen und mehr gratis herunterladen.
/ebooks-und-downloads/e-mail-m...E-Mail-Marketing für Anfänger Sie wollen mit E-Mail-Marketing beginnen, aber wissen nicht wie? Unser gratis E-Book mit allen E-Mail-Marketing Basics hilft Ih...
IMG-ALT E-Book - E-Mail-Marketing für Einsteiger:innen
https://www.rapidmail.de/hilfeHilfecenter Anleitungen und Hilfestellungen zur optimalen Nutzung unseres Newsletter-Tools: Hier finden Sie Antworten auf alle Ihre Fragen rund um rapidmail....
/hilfe/kategorie/mailingsMailing erstellen & versenden Gelungene Formatierung Ihrer Mailings, Nutzung des Editors, Versand planen, ...
/hilfe/kategorie/empfaengerEmpfängerverwaltung Empfängerlisten anlegen, Kontakte importieren, Segmentierung Ihrer Kontakte, ...
/hilfe/kategorie/zustellungZustellbarkeit DKIM, SPF und DMARC, Spam-Einstufung vermeiden, verbesserte Zustellbarkeit, ...
https://www.rapidmail.de/videosVideo-Tutorials Dank der einfachen Video-Anleitungen wird E-Mail-Marketing ein Kinderspiel für Sie — einfach einschalten, zurücklehnen, zuhören und umsetzen!...
https://www.rapidmail.de/kontaktKontakt
A-TITLE Kontakt
https://my.rapidmail.de/user/l...Neues Fenster Extern Subdomain Login
A-TITLE Bereits registriert?
https://www.rapidmail.de/registerKostenlos starten
A-TITLE Erstellen Sie jetzt Ihren ersten Newsletter
https://www.rapidmail.de/registerJetzt kostenlos starten
https://www.rapidmail.de/Anchor Mehr Informationen
https://www.rapidmail.de/Anchor 4,8 (1.928)
IMG-ALT OMR Reviews - Leader - E-Mail Marketing
A-TITLE Mehr Informationen
https://www.rapidmail.de/supportTextduplikat Mehr Informationen
A-TITLE Kostenloser Support
https://www.rapidmail.de/kontaktJetzt kontaktieren
A-TITLE Kontakt
/funktionen-newsletter-erstellenTextduplikat Mehr Informationen
/funktionen-newsletter-versendenTextduplikat Mehr Informationen
/funktionen-newsletter-reportingTextduplikat Mehr Informationen
/funktionen-kontakte-verwaltenTextduplikat Mehr Informationen
/funktionen-kontakte-gewinnenTextduplikat Mehr Informationen
/kostenlose-newsletter-vorlagenVorlagen entdecken
A-TITLE Kostenlose Newsletter-Vorlagen
https://omr.com/de/reviews/pro...Neues Fenster Extern Anchor IMG-ALT OMR Reviews
A-TITLE OMR Reviews
https://de.trustpilot.com/revi...Neues Fenster Extern Subdomain Textduplikat 4,8 (1.928)
IMG-ALT Trustpilot
A-TITLE Trustpilot
/warum-rapidmail-referenzenErfahrungen mit rapidmail
/smarte-software-fuer-ecommerc...E-Commerce
/effektives-newsletter-marketi...Unternehmen
/smartes-newsletter-tool-fuer-...Agenturen
/schnell-und-einfach-newslette...Vereine
/effizientes-email-marketing-f...Selbstständige
/newsletter-guides/den-ersten-...A-TITLE Den ersten Newsletter erstellen und versenden: So gelingt’s
/newsletter-guides/den-ersten-...Textduplikat Den ersten Newsletter erstellen und versenden: So gelingt’s
A-TITLE Den ersten Newsletter erstellen und versenden: So gelingt’s
/newsletter-guides/email-templ...A-TITLE Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
/newsletter-guides/email-templ...Textduplikat Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
A-TITLE Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
/blog/1-klick-design-fuer-auto...A-TITLE Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
/blog/1-klick-design-fuer-auto...Textduplikat Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
A-TITLE Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
https://www.rapidmail.de/blogMehr aus dem Blog
/newsletter-guidesNewsletter-Guides
/ebooks-und-downloadsE-Books
https://www.rapidmail.de/videosVideo-Tutorials
https://www.rapidmail.de/kontaktKontaktieren Sie uns gerne!
A-TITLE Kontakt
/funktionen-newsletter-erstellenNewsletter online gestalten
/funktionen-newsletter-reportingNewsletter-Reporting
/funktionen-kontakte-verwaltenNewsletter-Kontakte übersichtlich organisiert
/funktionen-kontakte-gewinnenneue Newsletter-Anmeldungen gewonnen werden. Über die
/funktionen-plugins-integrationenNewsletter-Plugins
/funktionen-transaktionsmails-...Versand von Transaktionsmails
/funktionen-plugins-integrationenTextduplikat Newsletter-Plugins
/dsgvo-konformes-email-marketingNewsletter-Marketing automatisch DSGVO-konform
/preise-newsletterversandNewsletterversand zu fairen Preisen
/preise-newsletterversandProbieren Sie es direkt aus!
https://www.rapidmail.de/kontaktkostenlosen Support
A-TITLE Kontakt
/newsletter-tool-vergleichNewsletter-Tool-Vergleich
https://www.rapidmail.de/kontaktTextduplikat Jetzt kontaktieren
A-TITLE Kontakt
/newsletter-funktionenFunktionen
/preise-newsletterversandTextduplikat Preise
/kostenlose-newsletter-vorlagenNewsletter-Vorlagen
/shopware-6-newsletter-integra...Shopware 6 Plugin
A-TITLE rapidmail Shopware 6 Newsletter-Plugin
https://www.rapidmail.de/supportKostenloser Support
/dsgvo-konformes-email-marketingDatenschutz & Sicherheit
/maximale-zustellbarkeit-fuer-...Zustellbarkeit & Whitelisting
/newsletter-tool-vergleichNewsletter-Tools
A-TITLE Der große Newsletter-Tool-Vergleich 2024
/mailchimp-rapidmail-vergleichrapidmail vs. Mailchimp
A-TITLE Deutsche Mailchimp Alternative
/sendinblue-rapidmail-vergleichrapidmail vs. Brevo (Sendinblue)
A-TITLE Brevo (Sendinblue) Alternative
/smarte-software-fuer-ecommerc...Textduplikat E-Commerce
/effektives-newsletter-marketi...Textduplikat Unternehmen
/smartes-newsletter-tool-fuer-...Textduplikat Agenturen
/schnell-und-einfach-newslette...Textduplikat Vereine
/effizientes-email-marketing-f...Textduplikat Selbstständige
/service-partnerService Partner
/affiliate-partnerAffiliate Partner
/ueber-rapidmailÜber uns
/warum-rapidmail-referenzenKundenstimmen
https://www.rapidmail.de/blogBlog
https://www.rapidmail.de/jobsJobs Wir stellen ein!
https://www.rapidmail.de/kontaktTextduplikat Kontakt
https://www.rapidmail.de/hilfeHilfecenter
https://www.rapidmail.de/videosTextduplikat Video-Tutorials
/newsletter-guidesTextduplikat Newsletter-Guides
/newsletter-guides/den-ersten-...Newsletter erstellen
/newsletter-guides/e-mail-mark...E-Mail-Marketing
/newsletter-guides/mit-direktm...Direktmarketing
/ebooks-und-downloadsE-Books & Downloads
/dsgvo-konformes-email-marketingDSGVO-konform
/maximale-zustellbarkeit-fuer-...CSA Whitelisting
/ueber-rapidmailMade in Freiburg
https://www.facebook.com/rapid...Neues Fenster Nofollow Extern Subdomain A-TITLE Facebook
https://de.linkedin.com/compan...Neues Fenster Nofollow Extern Subdomain A-TITLE LinkedIn
https://www.rapidmail.de/A-TITLE Startseite
/anti-spam-policyAnti-Spam-Policy
/datenschutzDatenschutz
https://www.rapidmail.de/agbAGB
/impressumImpressum

Serverkonfiguration

HTTP-Weiterleitungen
(Extrem wichtig)
Die Seite leitet weiter auf "https://www.rapidmail.de/"
HTTP-Header
(Wichtig)
Es wird kein X-Powered HTTP-Header mitgesendet.
Der Webserver nutzt GZip zur komprimierten Übertragung der Webseite (HTML).
Performance
(Wenig wichtig)
Die Antwortzeit der HTML-Seite ist mit 0,13 Sekunden unter der Zielmarke von 0,40 Sekunden.
Die Dateigröße des HTML-Dokuments ist mit 401 kB in Ordnung.

HTTP-Header

NameWert
servernginx
dateTue, 11 Jun 2024 20:56:12 GMT
content-typetext/html; charset=UTF-8
varyAccept-Encoding
set-cookie69 Zeichen
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-store, no-cache, must-revalidate
pragmano-cache
x-rm-ballb1
content-encodinggzip
statuscode200
http_versionHTTP/2

Externe Faktoren

Blacklists
(Nice to have)
Die Seite wird nicht als "nur für Erwachsene" eingestuft.
Die Seite ist exzellent von anderen Webseiten verlinkt.
Die Seite hat Backlinks von 6.739 verweisenden Domains.
Die Seite hat insgesamt 4.945.316 Backlinks.
Die Seite hat Backlinks von 4.214 verschiedenen IP Adressen.
Verbreitung bei Facebook
(Wenig wichtig)
Die Seite hat 2789 Shares und Kommentare auf Facebook.

Links von Wikipedia

Es wurden keine Links von Wikipedia gefunden.

Robots.txt

User-Agent: *
Disallow: /images/main/team/*
Disallow: /images/main/about_support/*
Disallow: /downloads/ebooks/*

Sitemap: https://www.rapidmail.de/sitemap.xml

Suchvorschau

www.rapidmail.de
Die einfach gute Newsletter-Software: rapidmail
Das DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!

Wichtigste Suchbegriffe

Folgende Keywords wurden erkannt. Überprüfe die Optimierung dieser Keywords für Deine Seite.

KeywordErgebnisPrüfen
einfach72%Check
rapidmail71%Check
einfach Newsletter64%Check
Newsletter61%Check
rapidmail Newsletter-Software58%Check
E-Mail-Marketing56%Check
Newsletter versenden55%Check
versenden54%Check
DSGVO-konform54%Check
Newsletter-Tool54%Check

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von rapidmail.de!

Kostenlos Testen
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Cookie Einstellungen

Wir verwenden Cookies, damit unsere Website funktioniert und auch für Analyse- und Werbezwecke. Du kannst optionale Cookies selbstverständlich auch deaktivieren, siehe die folgenden Links für weitere Informationen.

Diese Cookies werden für grundlegende Websitefunktionen benötigt.

Damit wir besser verstehen, wie Besucher unsere Website nutzen.

Damit wir für Dich passgenaue Angebote bereitstellen können.