Evolution.com.ec - SEO Checker

Overview of the SEO Check
Meta information
100% 
Page quality
48% 
Page structure
68% 
Link structure
75% 
Server
80% 
External factors
36% 
SEO Score
Response time
0.83 s
File size
74.00 kB
Words
496
Media files
149
Number of links
63 internal / 13 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Evolution │ Gestión de personas con Software en la nube
The length of the page title is perfect. (515 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
El software en la nube para la gestión de recursos humanos de Evolution, es un sistema de recursos humanos para la adminsitración de personal en Ecuador.
The length of the meta description is perfect. (975 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
No canonical link is specified.
Language
(Somewhat important)
Language detected in text: es
Language defined in HTML: es
Server location: United States of America
The following language is defined by HTML: es
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The character encoding is not specified in the HTTP header.
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0
authorMONKEY PLUS
descriptionEl software en la nube para la gestión de recursos humanos de Evolution, es un sistema de recursos humanos para la adminsitración de personal en Ecuador.
keywordssoftware en la nube, gestion de recursos humanos, administracion de recursos humanos, software de talento humano, administracion de personal, administracion del tiempo
langes
twitter:cardsummary_large_image
twitter:siteundefined
twitter:titleEvolution │ Gestión de personas con Software en la nube
twitter:descriptionEl software en la nube para la gestión de recursos humanos de Evolution, es un sistema de recursos humanos para la adminsitración de personal en Ecuador.
twitter:imagehttps://www.evolution.com.ec/assets/images/shared/metatag.jpg
twitter:urlhttps://evolution.com.ec
og:typewebsite
og:titleEvolution │ Gestión de personas con Software en la nube
og:descriptionEl software en la nube para la gestión de recursos humanos de Evolution, es un sistema de recursos humanos para la adminsitración de personal en Ecuador.
og:imagehttps://www.evolution.com.ec/assets/images/shared/metatag.jpg
og:urlhttps://evolution.com.ec
og:site_nameEvolution │ Gestión de personas con Software en la nube
X-UA-Compatibleie=edge
charsetUTF-8

Test up to 1.000 webpages of evolution.com.ec with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
Words from the H1 heading are not used in the page content.
Only 2 paragraph/s was/were found on this page.
There are only 496 words on this page. Good pages should have about 800 words of useful content.
These Typos were found:
  • administracion => administración
The average number of words per sentence of 32 words is high.
9.7% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
The page contains a listing, which indicates a good text layout.
No placeholders texts or images were found.
There are no duplicates on the site.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
A viewport "width=device-width, initial-scale=1.0" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 10 tags for this page.
Image SEO
(Somewhat important)
Alt text (alternative text) is correctly used on all found images.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/assets/_/images/shared/logo.svglogologo
/assets/_/images/shared/logo.svglogologo
/assets/_/images/index/banner2.jpgbanner2banner2
/assets/_/images/index/banner3.jpgbanner3banner3
/assets/_/images/index/servicio1.svgservicio1servicio1
/assets/_/images/index/servicio2.svgservicio2servicio2
/assets/_/images/index/servicio3.svgservicio3servicio3
/assets/_/images/index/servicio4.svgservicio4servicio4
/assets/_/images/index/talento.jpgtalentotalento
/assets/_/images/index/simplifica.jpgsimplificasimplifica
/assets/_/images/logos-clientes/1.png11
/assets/_/images/logos-clientes/2.png22
/assets/_/images/logos-clientes/3.png33
/assets/_/images/logos-clientes/4.png44
/assets/_/images/logos-clientes/5.png55
/assets/_/images/logos-clientes/6.png66
/assets/_/images/logos-clientes/7.png77
/assets/_/images/logos-clientes/8.png88
/assets/_/images/logos-clientes/9.png99
/assets/_/images/logos-clientes/10.png1010
/assets/_/images/logos-clientes/11.png1111
/assets/_/images/logos-clientes/12.png1212
/assets/_/images/logos-clientes/13.png1313
/assets/_/images/logos-clientes/14.png1414
/assets/_/images/logos-clientes/15.png1515
/assets/_/images/logos-clientes/16.png1616
/assets/_/images/logos-clientes/17.png1717
/assets/_/images/logos-clientes/18.png1818
/assets/_/images/logos-clientes/19.png1919
/assets/_/images/logos-clientes/20.png2020
/assets/_/images/logos-clientes/21.png2121
/assets/_/images/logos-clientes/22.png2222
/assets/_/images/logos-clientes/23.png2323
/assets/_/images/logos-clientes/24.png2424
/assets/_/images/logos-clientes/25.png2525
/assets/_/images/logos-clientes/26.png2626
/assets/_/images/logos-clientes/27.png2727
/assets/_/images/logos-clientes/28.png2828
/assets/_/images/logos-clientes/29.png2929
/assets/_/images/logos-clientes/30.png3030
/assets/_/images/logos-clientes/31.png3131
/assets/_/images/logos-clientes/32.png3232
/assets/_/images/logos-clientes/33.png3333
/assets/_/images/logos-clientes/34.png3434
/assets/_/images/logos-clientes/35.png3535
/assets/_/images/logos-clientes/36.png3636
/assets/_/images/logos-clientes/37.png3737
/assets/_/images/logos-clientes/38.png3838
/assets/_/images/logos-clientes/39.png3939
/assets/_/images/logos-clientes/40.png4040
/assets/_/images/logos-clientes/41.png4141
/assets/_/images/logos-clientes/42.png4242
/assets/_/images/logos-clientes/43.png4343
/assets/_/images/logos-clientes/44.png4444
/assets/_/images/logos-clientes/45.png4545
/assets/_/images/logos-clientes/46.png4646
/assets/_/images/logos-clientes/47.png4747
/assets/_/images/logos-clientes/48.png4848
/assets/_/images/logos-clientes/49.png4949
/assets/_/images/logos-clientes/50.png5050
/assets/_/images/logos-clientes/51.png5151
/assets/_/images/logos-clientes/52.png5252
/assets/_/images/logos-clientes/53.png5353
/assets/_/images/logos-clientes/54.png5454
/assets/_/images/logos-clientes/55.png5555
/assets/_/images/logos-clientes/56.png5656
/assets/_/images/logos-clientes/57.png5757
/assets/_/images/logos-clientes/58.png5858
/assets/_/images/logos-clientes/59.png5959
/assets/_/images/logos-clientes/60.png6060
/assets/_/images/logos-clientes/61.png6161
/assets/_/images/logos-clientes/62.png6262
/assets/_/images/logos-clientes/63.png6363
/assets/_/images/logos-clientes/64.png6464
/assets/_/images/logos-clientes/65.png6565
/assets/_/images/logos-clientes/66.png6666
/assets/_/images/logos-clientes/67.png6767
/assets/_/images/logos-clientes/68.png6868
/assets/_/images/logos-clientes/69.png6969
/assets/_/images/logos-clientes/70.png7070
/assets/_/images/logos-clientes/71.png7171
/assets/_/images/logos-clientes/72.png7272
/assets/_/images/logos-clientes/73.png7373
/assets/_/images/logos-clientes/74.png7474
/assets/_/images/logos-clientes/75.png7575
/assets/_/images/logos-clientes/76.png7676
/assets/_/images/logos-clientes/77.png7777
/assets/_/images/logos-clientes/78.png7878
/assets/_/images/logos-clientes/79.png7979
/assets/_/images/logos-clientes/80.png8080
/assets/_/images/logos-clientes/81.png8181
/assets/_/images/logos-clientes/82.png8282
/assets/_/images/logos-clientes/83.png8383
/assets/_/images/logos-clientes/84.png8484
/assets/_/images/logos-clientes/85.png8585
/assets/_/images/logos-clientes/86.png8686
/assets/_/images/logos-clientes/87.png8787
/assets/_/images/logos-clientes/88.png8888
/assets/_/images/logos-clientes/89.png8989
/assets/_/images/logos-clientes/90.png9090
/assets/_/images/logos-clientes/91.png9191
/assets/_/images/logos-clientes/92.png9292
/assets/_/images/logos-clientes/93.png9393
/assets/_/images/logos-clientes/94.png9494
/assets/_/images/logos-clientes/95.png9595
/assets/_/images/logos-clientes/96.png9696
/assets/_/images/logos-clientes/97.png9797
/assets/_/images/logos-clientes/98.png9898
/assets/_/images/logos-clientes/99.png9999
/assets/_/images/logos-clientes/100.png100100
/assets/_/images/logos-clientes/101.png101101
/assets/_/images/logos-clientes/102.png102102
/assets/_/images/logos-clientes/103.png103103
/assets/_/images/logos-clientes/104.png104104
/assets/_/images/logos-clientes/105.png105105
/assets/_/images/logos-clientes/106.png106106
/assets/_/images/logos-clientes/107.png107107
/assets/_/images/logos-clientes/108.png108108
/assets/_/images/logos-clientes/109.png109109
/assets/_/images/logos-clientes/110.png110110
/assets/_/images/logos-clientes/111.jpg111111
/assets/_/images/logos-clientes/112.png112112
/assets/_/images/logos-clientes/113.png113113
/assets/_/images/logos-clientes/114.jpg114114
/assets/_/images/logos-clientes/115.png115115
/assets/_/images/logos-clientes/116.png116116
/assets/_/images/logos-clientes/117.png117117
/assets/_/images/logos-clientes/118.png118118
/assets/_/images/logos-clientes/119.png119119
/assets/_/images/logos-clientes/120.png120120
/assets/_/images/logos-clientes/121.png121121
/assets/_/images/logos-clientes/122.png122122
/assets/_/images/logos-clientes/123.png123123
/assets/_/images/logos-clientes/acsa.pngacsaacsa
/assets/_/images/logos-clientes/cofimar.pngcofimarcofimar
...ets/_/images/logos-clientes/ecuavisa.pngecuavisaecuavisa
/assets/_/images/logos-clientes/export.pngexportexport
...images/logos-clientes/farmaciaskeyla.pngfarmaciaskeylafarmaciaskeyla
...images/logos-clientes/farmadescuento.pngfarmadescuentofarmadescuento
...mages/logos-clientes/hotelesoroverde.pnghotelesoroverdehotelesoroverde
/assets/_/images/logos-clientes/intaco.pngintacointaco
/assets/_/images/logos-clientes/negfar.pngnegfarnegfar
...ets/_/images/logos-clientes/oriental.pngorientaloriental
...ets/_/images/logos-clientes/plastlit.pngplastlitplastlit
...ets/_/images/logos-clientes/procarsa.pngprocarsaprocarsa
/assets/_/images/logos-clientes/quimpac.pngquimpacquimpac
/assets/_/images/logos-clientes/sgs.pngsgssgs
/assets/_/images/logos-clientes/vistazo.jpgvistazovistazo
Video URLWidthHeight
https://evolution.com.ec/video/video.mp4100%100%

Page structure

H1 heading
(Critically important)
software en la nube
The H1 heading is too short (19 characters). It should be at least 20 Characters long.
Headings
(Important)
Some headings occur twice on the page.
There are 36 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 software en la nube
H2 gestión de recursos humanos
H2 sistema de recursos humanos
H2 calculo de liquidacion ecuador
H2 gestión del talento
H3 software de talento humano
H3 seleccion de personal
H3 legislacion laboral
H3 calculo de horas extras
H3 administracion de recursos humanos
H3 evaluacion de desempeño
H3 actas de finiquito
H4 recursos humanos
H4 codigo de trabajo
H4 sistema de capital humano
H4 gestión de competencias
H4 seguridad y salud ocupacional
H4 riesgos del trabajo
H4 encuesta Salarial
H4 gestión de competencias Duplicate text
H4 gestión de reclutamiento
H4 software de RRHH
H4 administracion de personal
H5 evaluación de desempeño
H5 control de asistencia
H5 administracion de personal Duplicate text
H5 migracion de datos
H5 Seguridad Industrial
H5 transformación digital
H5 cálculo del destajo
H5 administracion del tiempo
H5 generar la liquidación de personal
H5 presupuesto de RRHH
H5 administracion de beneficios
H5 sistema de salarios
H5 gestión de posiciones
Some anchor texts are used more than once.
The number of internal links is ok.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are 13 external links on this page.
LinkAttributesAnchor text
https://evolution.com.ec/IMG-ALT logo
/software-de-talento-humano-re...Empresa
/administracion-de-recursos-hu...Soporte
/software-de-talento-humano-no...Clientes
/software-de-recursos-humanos-...Blog
/noticias-de-software-de-recur...Noticias
/software-gestion-de-talento-h...Gestión de Posiciones
/software-gestion-de-talento-h...Administración de Personal
/software-gestion-de-talento-h...Administración de Beneficios
/software-gestion-de-talento-h...Nómina
/software-gestion-de-talento-h...Liquidación de personal
/software-gestion-de-talento-h...Administración de tiempo
/software-gestion-de-talento-h...Permanencia - Rendimiento
/software-gestion-de-talento-h...Presupuesto de Recursos Humanos y Nomina
/software-gestion-de-talento-h...Salud Ocupacional y Seguridad Industrial
/software-gestion-de-talento-h...Gestión de Competencias
/software-gestion-de-talento-h...Evaluaciones
/software-gestion-de-talento-h...Capacitación
/software-gestion-de-talento-h...Reclutamiento y Selección
/software-gestion-de-talento-h...Plan de carrera y sucesiones
/software-gestion-de-talento-h...Valoración de puestos
/software-gestion-de-talento-h...Encuesta Salarial
/software-gestion-de-talento-h...Remuneración Variable
/software-gestion-de-talento-h...Clima Laboral
/software-gestion-de-talento-h...Reporter
/software-gestion-de-talento-h...Alarmas
/software-gestion-de-talento-h...Business Intelligence
/software-gestion-de-talento-h...E-business
/software-gestion-de-talento-h...Workflow
/software-gestion-de-talento-h...e-volution mobile
https://www.facebook.com/softw...New window External Subdomain No Text
https://twitter.com/evolution_swNew window External No Text
https://www.linkedin.com/compa...New window External Subdomain No Text
/software-de-talento-humano-re...Text duplicate Empresa
/administracion-de-recursos-hu...Text duplicate Soporte
/software-de-talento-humano-no...Text duplicate Clientes
/software-de-recursos-humanos-...Text duplicate Blog
/noticias-de-software-de-recur...Text duplicate Noticias
/software-gestion-de-talento-h...Text duplicate Gestión de Posiciones
/software-gestion-de-talento-h...Text duplicate Administración de Personal
/software-gestion-de-talento-h...Text duplicate Administración de Beneficios
/software-gestion-de-talento-h...Text duplicate Nómina
/software-gestion-de-talento-h...Text duplicate Liquidación de personal
/software-gestion-de-talento-h...Text duplicate Administración de tiempo
/software-gestion-de-talento-h...Text duplicate Permanencia - Rendimiento
/software-gestion-de-talento-h...Text duplicate Presupuesto de Recursos Humanos y Nomina
/software-gestion-de-talento-h...Text duplicate Salud Ocupacional y Seguridad Industrial
/software-gestion-de-talento-h...Text duplicate Gestión de Competencias
/software-gestion-de-talento-h...Text duplicate Evaluaciones
/software-gestion-de-talento-h...Text duplicate Capacitación
/software-gestion-de-talento-h...Text duplicate Reclutamiento y Selección
/software-gestion-de-talento-h...Text duplicate Plan de carrera y sucesiones
/software-gestion-de-talento-h...Text duplicate Valoración de puestos
/software-gestion-de-talento-h...Text duplicate Encuesta Salarial
/software-gestion-de-talento-h...Text duplicate Remuneración Variable
/software-gestion-de-talento-h...Text duplicate Clima Laboral
/software-gestion-de-talento-h...Text duplicate Reporter
/software-gestion-de-talento-h...Text duplicate Alarmas
/software-gestion-de-talento-h...Text duplicate Business Intelligence
/software-gestion-de-talento-h...Text duplicate E-business
/software-gestion-de-talento-h...Text duplicate Workflow
/software-gestion-de-talento-h...Text duplicate e-volution mobile
https://api.whatsapp.com/send?...New window External Subdomain Whatsapp
/software-gestion-de-talento-h...Conoce más
/software-gestion-de-talento-h...Text duplicate Conoce más
/software-gestion-de-talento-h...Text duplicate Conoce más
/software-gestion-de-talento-h...Text duplicate Conoce más
https://goo.gl/maps/Q7EHJjHuG6G2New window External Ver mapa Quito
https://goo.gl/maps/a5Tgb35Ld2C2New window External Ver mapa Guayaquil
https://www.facebook.com/softw...New window External Subdomain No Text
https://x.com/evolution_swNew window External No Text
https://www.linkedin.com/compa...New window External Subdomain No Text
https://www.youtube.com/@evolu...New window External Subdomain No Text
https://www.tiktok.com/@evolut...New window External Subdomain No Text
https://www.comparasoftware.ec...New window External Subdomain E-volution
https://www.comparasoftware.ec...External Subdomain Software de reclutamiento

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://evolution.com.ec/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time of 0.83 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is fine (74 kB).

HTTP Response Header

NameValue
content-typetext/html
content-length10258
x-ws-ratelimit-limit100
x-ws-ratelimit-remaining99
dateThu, 13 Mar 2025 20:32:40 GMT
serverApache
last-modifiedTue, 11 Feb 2025 17:39:17 GMT
etag"12806-62de14ddb255a-gzip"
accept-rangesbytes
cache-controlmax-age=2592000
expiresSat, 12 Apr 2025 20:32:40 GMT
varyAccept-Encoding,User-Agent
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

This page has only a few links from other websites.
This page only has backlinks from 12 referring domains.
This page only has 28 backlinks.
This page only has few backlinks from 11 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

User-Agent: *
Disallow: /antiguo/
Disallow: /antigua/
Disallow: /update/
Disallow: /logs/
Disallow: /mailer/
Disallow: /assets/data/
Disallow: /assets/fonts/
Disallow: /assets/mailer/
Disallow: /assets/static/

User-Agent: Googlebot
Disallow: /antiguo/
Disallow: /antigua/
Disallow: /update/
Disallow: /logs/
Disallow: /mailer/
Disallow: /assets/data/
Disallow: /assets/fonts/
Disallow: /assets/mailer/
Disallow: /assets/static/



Sitemap: http://evolution.com.ec/sitemap.xml

Search preview

evolution.com.ec
Evolution │ Gestión de personas con Software en la nube
El software en la nube para la gestión de recursos humanos de Evolution, es un sistema de recursos humanos para la adminsitración de personal en Ecuador.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
software76%Check
nube72%Check
evolution69%Check
gestión66%Check
Evolution Gestión de personas64%Check
de Personal63%Check
de Recursos63%Check
de Recursos Humanos60%Check
sistema de recursos humanos58%Check
de RRHH57%Check

Test up to 1.000 webpages of evolution.com.ec with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions