Level5.com.pl - SEO Checker

Overview of the SEO Check
Meta information
80% 
Page quality
64% 
Page structure
29% 
Link structure
92% 
Server
73% 
External factors
100% 
SEO Score
Response time
2.53 s
File size
72.70 kB
Words
604
Media files
185
Number of links
5 internal / 3 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
LEVEL 5 Lubin | Profesjonalna Reklama
The length of the page title is perfect. (359 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
LEVEL 5 – #reklamaLubin – Kompleksowa obsługa reklamowa firm, instytucji, placówek w Lubinie, tel. 791 49 72 77. Oferujemy: reklamę zewnętrzną, internetową, wydruki.
The meta description is too long: 1059 pixels from max. 1000 pixels. Optimize description
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.level5.com.pl/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: pl
Language defined in HTML: pl-pl
Server location: Poland
The following language is defined by HTML: pl-pl
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
descriptionLEVEL 5 – #reklamaLubin – Kompleksowa obsługa reklamowa firm, instytucji, placówek w Lubinie, tel. 791 49 72 77. Oferujemy: reklamę zewnętrzną, internetową, wydruki.
generatorDivi v.4.1
viewportwidth=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
langpl-pl
twitter:cardsummary
twitter:site@reklamalubin
twitter:creator@reklamalubin
twitter:titleLEVEL 5 Lubin | Profesjonalna Reklama
twitter:descriptionLEVEL 5 – #reklamaLubin – Kompleksowa obsługa reklamowa firm, instytucji, placówek w Lubinie, tel. 791 49 72 77. Oferujemy: reklamę zewnętrzną, internetową, wydruki.
og:localepl_PL
og:typewebsite
og:titleLEVEL 5 Lubin | Profesjonalna Reklama
og:descriptionLEVEL 5 – #reklamaLubin – Kompleksowa obsługa reklamowa firm, instytucji, placówek w Lubinie, tel. 791 49 72 77. Oferujemy: reklamę zewnętrzną, internetową, wydruki.
og:urlhttps://www.level5.com.pl/
og:site_nameLEVEL 5 Lubin
X-UA-CompatibleIE=edge
charsetUTF-8

Test up to 1.000 webpages of level5.com.pl with our free plan!

Sign Up Free
No trial. It's just free!

Page quality

Content
(Critically important)
Some words from the page title are not used within the pages content
Words from the H1 heading are not used in the page content.
This page contains 604 words. That's ok.
5% of the text are stop words.
The page contains a listing, which indicates a good text layout.
4 paragraphs were found on this page.
No placeholders texts or images were found.
There are no duplicates on the site.
The average number of words per sentence of 18 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
This page loads 7 JavaScript files. This may affect the load time negatively.
A viewport "width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 12 tags for this page.
Image SEO
(Somewhat important)
1 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/wp-content/uploads/2018/08/logo-l5-1.pngLEVEL 5 Lubin
/wp-content/uploads/2018/08/telefon.pngtelefon glownaglowna
/wp-content/uploads/2018/08/mail.pngmail glownaglowna
/wp-content/uploads/2018/08/email-4.pngemail-4 glownaglowna
/wp-content/uploads/2018/08/l5.pngl5 glownaglowna
/wp-content/uploads/2018/08/godziny.pnggodziny glownaglowna
/wp-content/uploads/2018/08/billboard.pngbillboard glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...content/uploads/2018/08/wielkiformat.pngwielkiformat glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/nadrukuv.pngnadrukuv glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...ent/uploads/2018/08/gadzetyreklamowe.pnggadzetyreklamowe glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
.../uploads/2018/08/grawerowanielaserem.pnggrawerowanielaserem glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...nt/uploads/2018/08/pieczatki-stemple.pngpieczatki-stemple glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...ontent/uploads/2018/08/uslugibiurowe.pnguslugibiurowe glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...uploads/2018/08/nadrukinatekstyliach.pngnadrukinatekstyliach glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...uploads/2018/08/oklejanie-wyklejanie.pngoklejanie-wyklejanie glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...ntent/uploads/2018/08/wydrukicyfrowe.pngwydrukicyfrowe glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...loads/2018/08/projektowaniegraficzne.pngprojektowaniegraficzne glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...t/uploads/2018/08/reklamainternetowa.pngreklamainternetowa glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
.../2018/08/upominkipodziekowaniatrofea.pngupominkipodziekowaniatrofea glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...nt/uploads/2018/08/reklamawewnetrzna.pngreklamawewnetrzna glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...tent/uploads/2018/08/wycinaniereklam.pngwycinaniereklam glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...tent/uploads/2018/08/dekoracjeslubne.pngdekoracjeslubne glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...tent/uploads/2018/08/uslugireklamowe.pnguslugireklamowe glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
...ent/uploads/2018/08/wydrukioffsetowe.pngwydrukioffsetowe glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/dot-5.pngdot-5 glownaglowna
/wp-content/uploads/2018/08/telefon.pngtelefon glownaglowna
/wp-content/uploads/2018/08/mail.pngmail glownaglowna
/wp-content/uploads/2018/08/email-4.pngemail-4 glownaglowna
/wp-content/uploads/2018/08/l5.pngl5 glownaglowna
/wp-content/uploads/2018/08/godziny.pnggodziny glownaglowna
...tent/uploads/2018/08/level5-dol-logo.pngNo alt attribute provided

Page structure

H1 heading
(Critically important)
/ LEVEL 5 czyli #reklamaLubin
Too many H1 headings
Headings
(Important)
Some headings occur twice on the page.
The structure of headings is missing one or more levels. Do not skip heading levels.
There are 41 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 / LEVEL 5 czyli #reklamaLubin
H1 oferta / LEVEL 5 / #reklamaLubin
H1 REKLAMA ZEWNĘTRZNA
H1 /OUTDOOR (OOH)
H1 WYDRUKI
H1 WIELKOFORMATOWE
H1 BEZPOŚREDNI
H1 NADRUK UV
H1 GADŻETY
H1 REKLAMOWE
H1 GRAWEROWANIE
H1 /CIĘCIE LASEREM
H1 PIECZĄTKI
H1 /STEMPLE
H1 USŁUGI
H1 /BIUROWE
H1 NADRUKI
H1 /NA ODZIEŻY
H1 OKLEJANIE
H1 /WYKLEJANIE REKLAM
H1 WYDRUKI Duplicate text
H1 /CYFROWE
H1 PROJEKTOWANIE
H1 /GRAFICZNE
H1 REKLAMA
H1 /INTERNETOWA
H1 UPOMINKI
H1 /PODZIĘKOWANIA
H1 REKLAMA WEWNĘTRZNA
H1 /INDOOR
H1 WYCINANIE
H1 /REKLAM
H1 UPOMINKI Duplicate text
H1 /DEKORACJE ŚLUBNE
H1 USŁUGI Duplicate text
H1 /REKLAMOWE
H1 WYDRUKI Duplicate text
H1 /OFFSETOWE
H3 LEVEL 5
H6 #reklamaLubin
H6 : Legnica, Polkowice, Chojnów, Chocianów, Ścinawa, Jawor, Legnica
There are too few (5) internal links on this page.
Every linktext is unique.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are 3 external links on this page.
LinkAttributesAnchor text
https://www.level5.com.pl/IMG-ALT LEVEL 5 Lubin
https://level5.pl/External Marketing
/baneryreklamowe/Banery reklamowe Fronlit
https://www.level5.com.pl/ulotki/Ulotki
/wizytowki/Wizytówki
https://www.level5.com.pl/ulotki/Ulotki reklamowe
https://sklep.l5.pl/zasady-wsp...External Zasady współpracy
https://sklep.l5.pl/polityka-p...External Polityka prywatności

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.level5.com.pl/"
HTTP header
(Important)
The X-powered header is sent within the response header. (unnecessary)
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time is very slow (2.53 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
This page loads 5 CSS files. This may affect the page load time negatively.
This page loads 7 JavaScript files. This may affect the load time negatively.
The file size of the HTML document is fine (73 kB).

HTTP Response Header

NameValue
servernginx
dateWed, 28 Oct 2020 19:48:55 GMT
content-typetext/html; charset=UTF-8
x-powered-byPHP/7.1.33
link<https://www.level5.com.pl/wp-json/>; rel="https://api.w.org/"
link<https://www.level5.com.pl/>; rel=shortlink
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Critically important)
This website is not classified "for adult only".
This website is not listed on the Shallalist.
This website has excellent links from other websites.
This page has backlinks from 564 referring domains.
This page has 51,742 backlinks.
This page has backlinks from 516 different ip addresses.
Facebook popularity
(Somewhat important)
This page has social activity like shares, comments or likes on facebook.
Listed on Webwiki
(Nice to have)
This website is listed on Webwiki.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

User-agent: *
Disallow: /wp-admin/
Allow: /wp-admin/admin-ajax.php

Sitemap: https://www.level5.com.pl/sitemap.xml

Facebook popularity

Shares / Likes / Comments
727

Only the data for the given URL is shown. We cannot determine the social actions for a linked fan page.

Search preview

www.level5.com.pl
LEVEL 5 Lubin | Profesjonalna Reklama
LEVEL 5 – #reklamaLubin – Kompleksowa obsługa reklamowa firm, instytucji, placówek w Lubinie, tel. 791 49 72 77. Oferujemy: reklamę zewnętrzną, internetową, wydruki.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
LEVEL93%Check
LEVEL Lubin86%Check
Reklam81%Check
REKLAMA81%Check
Lubin79%Check
reklamaLubin66%Check
WYKLEJANIE REKLAM63%Check
reklama internetowa63%Check
Reklama mobilna59%Check
REKLAMA MARKETING59%Check

Test up to 1.000 webpages of level5.com.pl with our free plan!

Sign Up Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions