Tischtennis.biz - SEO Checker

Overview of the SEO Check
Meta information
98% 
Page quality
94% 
Page structure
100% 
Link structure
25% 
Server
66% 
External factors
100% 
SEO Score
Response time
0.95 s
File size
91.80 kB
Words
1290
Media files
14
Number of links
190 internal / 1 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Tischtennis.biz - der TT-Shop mit der guten Beratung
The domain is used in the page's title.
There are no duplicate words in the title
Meta description
(Critically important)
Tischtennisshop für Profi- und Hobby Tischtennis seit 1994. Gerne helfen wir dir bei deiner Auswahl rund um Tischtennis ☎ 0551-5311828
The length of the meta description is perfect. (852 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.tischtennis.biz/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de
Server location: United States of America
The following language is defined by HTML: de
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1
descriptionTischtennisshop für Profi- und Hobby Tischtennis seit 1994. Gerne helfen wir dir bei deiner Auswahl rund um Tischtennis ☎ 0551-5311828
keywordsTischtennis Tischtennisshop Tischtennisbeläge Tischtennishölzer Tischtennisplatten wetterfeste Tischtennistisch Tischtennisbälle Tischtennisschläger Cornille Sponeta Joola Xiom Tibhar OSP-Blades
msapplication-TileColor#D83434
theme-color#D83434
msapplication-TileImagehttps://www.tischtennis.biz/out/tt/img/favicons/favicon_512x512.png
langde
og:site_namehttps://www.tischtennis.biz/
og:titleStartseite | der günstige Tischtennis-Shop
og:descriptionTischtennis.biz » der Tischtennis Shop ✓ große Auswahl ✓ viele Marken ✓ persönliche Beratung vom Experten: Fachgeschäft seit 1994, Online TT-Shop seit 1998!
og:typewebsite
og:imagehttps://www.tischtennis.biz/out/tt/img/basket.png
og:urlhttps://www.tischtennis.biz/
X-UA-CompatibleIE=edge
Content-Typetext/html; charset=UTF-8

Test up to 1.000 webpages of tischtennis.biz with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
This page contains 1290 words. That's ok.
35% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
Words from the H1 heading are used in the page content.
The page contains a listing, which indicates a good text layout.
12 paragraphs were found on this page.
The text content is perfect.
No placeholders texts or images were found.
There are no duplicates on the site.
The average number of words per sentence of 10.89 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 26 tags for this page.
Image SEO
(Somewhat important)
Alt text (alternative text) is correctly used on all found images.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/out/tt/img/logo_tischtennis-shop.pngLogo Tischtennis Shophier kommst du wieder auf die Startseite des Tischtennis Shops
/out/tt/img/logo_tischtennis-shop.pngTischtennis Shop Logo
...es/promo/beton-tischtennisplatte_748.jpgBetontischtennisplattenextrem stabile Betontischtennisplatten, besonders geeignet für Schulhöfe, Spielplätze und Parks
/out/pictures/promo/joola-dynaryz_748.jpgJoola Dynaryzfinde den richtigen Tischtennisbelag für dein Spiel
...romo/cornilleau-500m-crossover-spiel.jpgTischtennisplatte Outdoortolle Auswahl wetterfester Tischtennosplatten für den Outdoor Bereich
/out/pictures/ddmedia/markus-thies_170.jpgMarkus Thies seit 1994 im TischtennishandelMarkus Thies unterstützt Tischtennisspieler seit 30 Jahren bei der Auswahl ihres Materials
/out/tt/img/spinner.gifSparset: 2 x Cornilleau 740 Tischtennistisch
/out/tt/img/spinner.gifProfi Tischtennisschläger
/out/tt/img/spinner.gifJoola Holz Tezzo Paladin
/out/tt/img/spinner.gifPremium Set Cornilleau 600X Outdoor Tischtennisplatte
/out/tt/img/spinner.gifCornilleau Tischtennisplatte Park
/out/tt/img/spinner.gifOSP Virtuoso OFF-
/out/tt/img/spinner.gifBetontischtennistisch TTpur® Standard
/out/tt/img/spinner.gifTest the ball - 15 Plastik Tischtennisbälle

Page structure

H1 heading
(Critically important)
Dein Tischtennis Shop mit der guten Beratung
The H1 heading is perfect.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 Dein Tischtennis Shop mit der guten Beratung
H2 Besondere Angebote des Tischtennisshops
H2 Topseller bei Tischtennisschlägern, Tischtennisplatten und Bällen
H2 Beläge, Hölzer, Schläger, Trikots und Tischtennisplatten auf Rechnung im Shop bestellen und kaufen
H2 Über Cookies auf dieser Website
H3 Wir helfen Dir bei der Auswahl des Tischtennisschlägers
H3 Tischtennisplatten (outdoor / indoor) und Zubehör
H4 einige Tipps für die richtige Auswahl Deines TT-Schlägers
Some internal links have dynamic parameters. All internal URLs, which are not marked as nofollow, should not contain dynamic parameters.
Some anchor texts are used more than once.
4 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
There are 1 external links on this page.
LinkAttributesAnchor text
https://www.tischtennis.biz/Subdomain IMG-ALT Logo Tischtennis Shop
/index.php?cl=accountSubdomain Mein Konto
/index.php?cl=compareSubdomain Mein Artikelvergleich
/index.php?cl=account_noticelistSubdomain Mein Merkzettel
/index.php?cl=forgotpwdSubdomain ?
A-TITLE Passwort vergessen?
/index.php?cl=registerSubdomain Registrieren
A-TITLE Registrieren
/index.php?cl=forgotpwdSubdomain Passwort vergessen?
https://www.tischtennis.biz/Subdomain IMG-ALT Tischtennis Shop Logo
A-TITLE Startseite
https://www.tischtennis.biz/Subdomain Startseite
https://www.tischtennis.biz/Anchor Spieler
https://www.tischtennis.biz/Anchor Zurück Menü
/spielerbedarf/Subdomain Kategorieübersicht Spieler
/tischtennisbelaege/Subdomain Tischtennisbeläge
/tischtennishoelzer/Subdomain Tischtennishölzer
/kleber-cleaner/Subdomain Kleber&Cleaner
/wettkampf-tischtennisschlaeger/Subdomain Tischtennisschläger (kompl.)
/taschen-huellen/Subdomain Taschen&Hüllen
/textil/Subdomain Textil
/tischtennis-baelle/Subdomain Tischtennis Bälle
/tischtennisschuhe/Subdomain Tischtennisschuhe
/tischtennisspieler-diverse/Subdomain Diverse
https://www.tischtennis.biz/Anchor Vereine
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/vereinsbedarf/Subdomain Kategorieübersicht Vereine
/tischtennistische/Subdomain Tischtennistische
/vereinsbedarf-diverse/Subdomain Zubehör
/bekleidung/Subdomain Bekleidung
/tischtennisbaelle/Subdomain Tischtennisbälle
/tischtennisroboter/Subdomain Tischtennisroboter
https://www.tischtennis.biz/Anchor Hobby
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/hobby-tischtennis/Subdomain Kategorieübersicht Hobby
/outdoor-tischtennisplatten/Subdomain Outdoor Tischtennisplatten
/tischtennisplatten/Subdomain Indoor Tischtennisplatten
/auswahl-einer-tischtennisplatte/Subdomain Tischtennisplatte: Fragen zur Auswahl (Ratgeber)
/ersatzteile-tischtennisplatte/Subdomain Ersatzteile für Tischtennisplatten
/tischtennisnetze/Subdomain Tischtennisnetze
/zubehoer-tische/Subdomain Zubehör-Tische
/schlaeger-huellen/Subdomain Schlägerhüllen
/tischtennisschlaeger/Subdomain Tischtennisschläger
/hobby-tischtennis/tt-baelle/Subdomain TT-Bälle
https://www.tischtennis.biz/Anchor Schulen & Co
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/tischtennis-schule/Subdomain Kategorieübersicht Schulen & Co
/tischtennis-schule/tt-tische-...Subdomain TT-Tische für Innen
/beton-tischtennistische/Subdomain Beton Tischtennistische
/tischtennis-schlaeger-gross/Subdomain Tischtennis Schläger
/andere-sportarten/Subdomain andere Sportarten
https://www.tischtennis.biz/Anchor Training
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/training/Subdomain Kategorieübersicht Training
/training/billard/Subdomain Billard
/andere-sportarten/kicker/Subdomain Kicker
/training/teqball/Subdomain Teqball
/training/gesundheit/Subdomain Gesundheit
/headis/Subdomain Headis
https://www.tischtennis.biz/Anchor Angebote
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/angebote/Subdomain Kategorieübersicht Angebote
/angebote/angebot-des-monats/Subdomain Angebot des Monats
/angebote/neue-tischtennisarti...Subdomain Neue Tischtennisartikel im Shop
/angebote/kombi-angebote/Subdomain Kombi Angebote
/restposten/Subdomain Restposten
/belaege-hoelzer/Subdomain Beläge & Hölzer
/tischtennis-vereine/Subdomain für Vereine
/hobby/Subdomain Text duplicate Hobby
https://www.tischtennis.biz/Anchor vor Ort
https://www.tischtennis.biz/Anchor Text duplicate Zurück Menü
/laden/Subdomain Kategorieübersicht vor Ort
/ansprechpartner-bei-tischtenn...Subdomain Ansprechpartner bei Tischtennis pur
/ueber-uns/Subdomain Über uns
/laden/butterfly-store/Subdomain Butterfly-Store
/service-regional/Subdomain Service
/laden-oeffnungszeiten/Subdomain Laden&Öffnungszeiten
/laden/material-test/Subdomain Material-Test
/ttblog/Subdomain TT-Blog
https://www.tischtennis.biz/Subdomain Text duplicate Startseite
/spielerbedarf/Subdomain Text duplicate Spieler
/tischtennisbelaege/Subdomain Text duplicate Tischtennisbeläge
/tischtennishoelzer/Subdomain Text duplicate Tischtennishölzer
/kleber-cleaner/Subdomain Text duplicate Kleber&Cleaner
/wettkampf-tischtennisschlaeger/Subdomain Text duplicate Tischtennisschläger (kompl.)
/taschen-huellen/Subdomain Text duplicate Taschen&Hüllen
/textil/Subdomain Text duplicate Textil
/tischtennis-baelle/Subdomain Text duplicate Tischtennis Bälle
/tischtennisschuhe/Subdomain Text duplicate Tischtennisschuhe
/tischtennisspieler-diverse/Subdomain Text duplicate Diverse
/vereinsbedarf/Subdomain Text duplicate Vereine
/tischtennistische/Subdomain Text duplicate Tischtennistische
/vereinsbedarf-diverse/Subdomain Text duplicate Zubehör
/bekleidung/Subdomain Text duplicate Bekleidung
/tischtennisbaelle/Subdomain Text duplicate Tischtennisbälle
/tischtennisroboter/Subdomain Text duplicate Tischtennisroboter
/hobby-tischtennis/Subdomain Text duplicate Hobby
/outdoor-tischtennisplatten/Subdomain Text duplicate Outdoor Tischtennisplatten
/tischtennisplatten/Subdomain Text duplicate Indoor Tischtennisplatten
/auswahl-einer-tischtennisplatte/Subdomain Text duplicate Tischtennisplatte: Fragen zur Auswahl (Ratgeber)
/ersatzteile-tischtennisplatte/Subdomain Text duplicate Ersatzteile für Tischtennisplatten
/tischtennisnetze/Subdomain Text duplicate Tischtennisnetze
/zubehoer-tische/Subdomain Text duplicate Zubehör-Tische
/schlaeger-huellen/Subdomain Text duplicate Schlägerhüllen
/tischtennisschlaeger/Subdomain Text duplicate Tischtennisschläger
/hobby-tischtennis/tt-baelle/Subdomain Text duplicate TT-Bälle
/tischtennis-schule/Subdomain Text duplicate Schulen & Co
/tischtennis-schule/tt-tische-...Subdomain Text duplicate TT-Tische für Innen
/beton-tischtennistische/Subdomain Text duplicate Beton Tischtennistische
/tischtennis-schlaeger-gross/Subdomain Text duplicate Tischtennis Schläger
/andere-sportarten/Subdomain Text duplicate andere Sportarten
/training/Subdomain Text duplicate Training
/training/billard/Subdomain Text duplicate Billard
/andere-sportarten/kicker/Subdomain Text duplicate Kicker
/training/teqball/Subdomain Text duplicate Teqball
/training/gesundheit/Subdomain Text duplicate Gesundheit
/headis/Subdomain Text duplicate Headis
/angebote/Subdomain Text duplicate Angebote
/angebote/angebot-des-monats/Subdomain Text duplicate Angebot des Monats
/angebote/neue-tischtennisarti...Subdomain Text duplicate Neue Tischtennisartikel im Shop
/angebote/kombi-angebote/Subdomain Text duplicate Kombi Angebote
/restposten/Subdomain Text duplicate Restposten
/belaege-hoelzer/Subdomain Text duplicate Beläge & Hölzer
/tischtennis-vereine/Subdomain Text duplicate für Vereine
/hobby/Subdomain Text duplicate Hobby
/laden/Subdomain Text duplicate vor Ort
/ansprechpartner-bei-tischtenn...Subdomain Text duplicate Ansprechpartner bei Tischtennis pur
/ueber-uns/Subdomain Text duplicate Über uns
/laden/butterfly-store/Subdomain Text duplicate Butterfly-Store
/service-regional/Subdomain Text duplicate Service
/laden-oeffnungszeiten/Subdomain Text duplicate Laden&Öffnungszeiten
/laden/material-test/Subdomain Text duplicate Material-Test
/ttblog/Subdomain Text duplicate TT-Blog
/index.php?cl=basketNofollow Subdomain No Text
https://www.tischtennis.biz/Subdomain Text duplicate A-TITLE Startseite
/index.php?cl=accountSubdomain No Text
/index.php?cl=basketSubdomain No Text
https://www.tischtennis.biz/Anchor weitere Infos zum TT-Shop
A-TITLE über den Tischtennisshop
/beton-tischtennistische/Subdomain Betontischtennisplatten extrem robuste Tischtennisplatten aus Beton für den Schulhof
IMG-ALT Betontischtennisplatten
/joola-tischtennisbelaege/Subdomain Joola Dynariz aktuelle Tischtennisbeläge für Profis und Vereinsspieler
IMG-ALT Joola Dynaryz
/outdoor-tischtennisplatten/Subdomain Outdoor Tischtennisplatten beste Auswahl an wetterfesten Tischtennisplatten für deinen Garten
IMG-ALT Tischtennisplatte Outdoor
/rss/tischtennis-biz/schnaeppc...New window Subdomain No Text
/tischtennistische/vereine/spa...Subdomain IMG-ALT Sparset: 2 x Cornilleau 740 Tischtennistisch
A-TITLE Sparset: 2 x Cornilleau 740 Tischtennistisch
/tischtennistische/vereine/spa...Subdomain Text duplicate Sparset: 2 x Cornilleau 740 Tischtennistisch
A-TITLE Sparset: 2 x Cornilleau 740 Tischtennistisch
/tischtennistische/vereine/spa...Subdomain Mehr Informationen
/tischtennisschlaeger/profi-ti...Subdomain IMG-ALT Profi Tischtennisschläger
A-TITLE Profi Tischtennisschläger
/tischtennisschlaeger/profi-ti...Subdomain Text duplicate Profi Tischtennisschläger
A-TITLE Profi Tischtennisschläger
/tischtennisschlaeger/profi-ti...Subdomain Text duplicate Mehr Informationen
/joola-tischtennishoelzer/jool...Subdomain IMG-ALT Joola Holz Tezzo Paladin
A-TITLE Joola Holz Tezzo Paladin
/joola-tischtennishoelzer/jool...Subdomain Text duplicate Joola Holz Tezzo Paladin
A-TITLE Joola Holz Tezzo Paladin
/joola-tischtennishoelzer/jool...Subdomain Text duplicate Mehr Informationen
/outdoor-tischtennisplatten/pr...Subdomain IMG-ALT Premium Set Cornilleau 600X Outdoor Tischtennisplatte
A-TITLE Premium Set Cornilleau 600X Outdoor Tischtennisplatte
/outdoor-tischtennisplatten/pr...Subdomain Text duplicate Premium Set Cornilleau 600X Outdoor Tischtennisplatte
A-TITLE Premium Set Cornilleau 600X Outdoor Tischtennisplatte
/outdoor-tischtennisplatten/pr...Subdomain Text duplicate Mehr Informationen
/rss/tischtennis-biz/top-of-th...New window Subdomain No Text
/cornilleau-tischtennisplatte-...Subdomain IMG-ALT Cornilleau Tischtennisplatte Park
A-TITLE Cornilleau Tischtennisplatte Park
/cornilleau-tischtennisplatte-...Subdomain Text duplicate Cornilleau Tischtennisplatte Park
A-TITLE Cornilleau Tischtennisplatte Park
/cornilleau-tischtennisplatte-...Subdomain Text duplicate Mehr Informationen
/tischtennishoelzer/osp-blades...Subdomain IMG-ALT OSP Virtuoso OFF-
A-TITLE OSP Virtuoso OFF-
/tischtennishoelzer/osp-blades...Subdomain Text duplicate OSP Virtuoso OFF-
A-TITLE OSP Virtuoso OFF-
/tischtennishoelzer/osp-blades...Subdomain Text duplicate Mehr Informationen
/beton-tischtennistische/beton...Subdomain IMG-ALT Betontischtennistisch TTpur® Standard
A-TITLE Betontischtennistisch TTpur® Standard
/beton-tischtennistische/beton...Subdomain Text duplicate Betontischtennistisch TTpur® Standard
A-TITLE Betontischtennistisch TTpur® Standard
/beton-tischtennistische/beton...Subdomain Text duplicate Mehr Informationen
/tischtennis-baelle/plastik-ti...Subdomain IMG-ALT Test the ball - 15 Plastik Tischtennisbälle
A-TITLE Test the ball - 15 Plastik Tischtennisbälle
/tischtennis-baelle/plastik-ti...Subdomain Text duplicate Test the ball - 15 Plastik Tischtennisbälle
A-TITLE Test the ball - 15 Plastik Tischtennisbälle
/tischtennis-baelle/plastik-ti...Subdomain Text duplicate Mehr Informationen
/tischtennisbelaege/Subdomain Text duplicate Tischtennisbeläge
/tischtennisschlaeger/profi-ti...Tischtennisschlägers
A-TITLE Ein von uns konfigurierter Tischtennisschläger
/outdoor-tischtennisplatten/wetterfeste outdoor Tischtennisplatte
A-TITLE getestete wetterfeste Tischtennisplatten in der Auswahl
/index.php?cl=contactSubdomain Kontakt
/index.php?cl=basketSubdomain Warenkorb
/index.php?cl=accountSubdomain Konto
/index.php?cl=account_noticelistSubdomain Merkzettel
/partnerprogramm/Subdomain Partnerprogramm
/lexikon/Subdomain Lexikon
/index.php?cl=dgcookieconsento...Subdomain Cookie-Einstellungen
/impressum/Subdomain Impressum
https://www.tischtennis.biz/agb/Subdomain AGB
/datenschutz/Subdomain Datenschutz
/versand/Subdomain Versand
/widerrufsrecht/Subdomain Widerrufsrecht
/wie-bestellen/Subdomain Wie Bestellen ?
/index.php?cl=newsletterSubdomain Newsletter
/ttblog/Blog
/outdoor-tischtennisplatten/Text duplicate Outdoor Tischtennisplatten
/tischtennisschlaeger/Text duplicate Tischtennisschläger
/tischtennisbelaege/Text duplicate Tischtennisbeläge
/tischtennishoelzer/Text duplicate Tischtennishölzer
/versand/Subdomain Versandkosten
https://www.tischtennis-pur.de/New window External Subdomain Tischtennis pur e.K.
A-TITLE Tischtennis pur -- Tischtennis-News Forum Turniere
/index.php?cl=dgcookieconsento...Subdomain Einstellungen
/datenschutz/Subdomain Text duplicate Datenschutz
/impressum/Subdomain Text duplicate Impressum

Server configuration

HTTP redirects
(Critically important)
The checked page does not redirect to another URL.
HTTP header
(Important)
The X-powered header is sent within the response header. (unnecessary)
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time of 0.95 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is fine (92 kB).

HTTP Response Header

NameValue
dateThu, 31 Oct 2024 07:08:25 GMT
content-typetext/html; charset=UTF-8
x-powered-byPHP/7.4.33
set-cookie36 Characters
varyAccept-Encoding,User-Agent
cf-cache-statusBYPASS
server-timingcfCacheStatus;desc="BYPASS"
report-to{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=fgHYX2xAY5%2BX8vVMkKpG7EF2uuEcBgb8Ulk1oDqkve0LXREhradvjq6tpnwFugbt3I9yv2essfcV%2BM4biwJCYqQmngVd30c%2B1eg31EwXobeyU2VvkeFCSn4uxEV8n5m1vbNb5HSqpKE42j8IdMPf8fg%3D"}],"group":"cf-nel","max_age":604800}
nel{"success_fraction":0,"report_to":"cf-nel","max_age":604800}
servercloudflare
cf-ray8db1d04b6f0e8f27-FRA
content-encodinggzip
alt-svch3=":443"; ma=86400
statuscode200
http_versionHTTP/2

External factors

This website has excellent links from other websites.
This page has backlinks from 146 referring domains.
This page has 10,662 backlinks.
This page has backlinks from 118 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

Sitemap: https://www.tischtennis.biz/sitemapindex.xml


User-agent: *
Disallow: /admin/
Disallow: /Core/
Disallow: /tmp/
Disallow: /views/
Disallow: /Setup/
Disallow: /log/
#
Disallow: /newsletter/
Disallow: /en/newsletter/
Disallow: /index.php?cl=newsletter
#
Disallow: /AGB/
Disallow: /en/Terms-and-Conditions/
#
Disallow: /warenkorb/
Disallow: /en/cart/
Disallow: /index.php?cl=basket
#
Disallow: /mein-konto/
Disallow: /en/my-account/
Disallow: /index.php?cl=account
#
Disallow: /mein-merkzettel/
Disallow: /en/my-wishlist/
Disallow: /index.php?cl=account_noticelist
#
Disallow: /mein-wunschzettel/
Disallow: /en/my-gift-registry/
Disallow: /index.php?cl=account_wishlist
#
Disallow: /konto-eroeffnen/
Disallow: /en/open-account/
Disallow: /index.php?cl=register
#
Disallow: /passwort-vergessen/
Disallow: /en/forgot-password/
Disallow: /index.php?cl=forgotpwd
#
Disallow: /index.php?cl=moredetails
#
Disallow: /index.php?cl=review
#
Disallow: /index.php?cl=search
#
Disallow: /EXCEPTION_LOG.txt
#
# wildcards at the end, because of some crawlers see it as errors
Disallow: /*?cl=newsletter
Disallow: /*&cl=newsletter
#
Disallow: /*?cl=basket
Disallow: /*&cl=basket
#
Disallow: /*?cl=account
Disallow: /*&cl=account
#
Disallow: /*?cl=account_noticelist
Disallow: /*&cl=account_noticelist
#
Disallow: /*?cl=account_wishlist
Disallow: /*&cl=account_wishlist
#
Disallow: /*?cl=register
Disallow: /*&cl=register
#
Disallow: /*?cl=forgotpwd
Disallow: /*&cl=forgotpwd
#
Disallow: /*?cl=moredetails
Disallow: /*&cl=moredetails
#
Disallow: /*?cl=review
Disallow: /*&cl=review
#
Disallow: /*?cl=search
Disallow: /*&cl=search
#
Disallow: /*&fnc=tobasket
Disallow: /*&fnc=tocomparelist
Disallow: /*&addcompare=
#
Disallow: /*/sid/
Disallow: /*?sid=
Disallow: /*&sid=
#
Disallow: /*?cur=
Disallow: /*&cur


# 09-2018 @https://www.deepcrawl.com/knowledge/best-practice/robots-txt-noindex-the-best-kept-secret-in-seo/
Noindex: /agb/
Noindex: /Impressum/
Noindex: /passwort-vergessen/
Noindex: /konto-eroeffnen/
Noindex: /wie-bestellen/
Noindex: /Widerrufsrecht/
Noindex: /Versand/
Noindex: /sicherheits-informationen/
Noindex: /zahlungsmoeglichkeiten/
Noindex: /links/
Noindex: /warenkorb/
Noindex: /mein-konto/
Noindex: /mein-merkzettel/
Noindex: /mein-wunschzettel/
Noindex: /wunschzettel/
Noindex: /kontakt/
Noindex: /artikelliste/
Noindex: /newsletter/

# 09-2024 Spider
User-agent: facebookexternalhit
Disallow: /
User-agent: nbot
Disallow: /
User-agent: facebook
Disallow: /
User-agent: oBot
Disallow: /
User-agent: MJ12bot
Disallow: /
User-agent: DotBot
Disallow: /
User-agent: SemrushBot
Disallow: /

User-agent: AboutUsBot
Disallow: /
User-agent: Amfibibot
Disallow: /
User-agent: antibot
Disallow: /
User-agent: appie
Disallow: /
User-agent: Aqua_Products
Disallow: /
User-agent: asterias
Disallow: /
User-agent: b2w/0.1
Disallow: /
User-agent: BackDoorBot
Disallow: /
User-agent: BackDoorBot/1.0
Disallow: /
User-agent: baiduspider
Disallow: /
User-agent: BecomeBot
Disallow: /
User-agent: BlowFish
Disallow: /
User-agent: BlowFish/1.0
Disallow: /
User-agent: Bookmark search tool
Disallow: /
User-agent: BotALot
Disallow: /
User-agent: BruinBot
Disallow: /
User-agent: btbot
Disallow: /
User-agent: BuiltBotTough
Disallow: /
User-agent: Bullseye
Disallow: /
User-agent: Bullseye/1.0
Disallow: /
User-agent: BunnySlippers
Disallow: /
User-agent: cfetch
Disallow: /
User-agent: CheeseBot
Disallow: /
User-agent: CherryPicker
Disallow: /
User-agent: CherryPickerElite/1.0
Disallow: /
User-agent: CherryPickerSE/1.0
Disallow: /
User-agent: CoolBot
Disallow: /
User-agent: CopyRightCheck
Disallow: /
User-agent: cosmos
Disallow: /
User-agent: Cowbot
Disallow: /
User-agent: Crescent
Disallow: /
User-agent: Crescent Internet ToolPak HTTP OLE Control v.1.0
Disallow: /
User-agent: CydralSpider
Disallow: /
User-agent: dcbspider
Disallow: /
User-agent: DittoSpyder
Disallow: /
User-agent: dotbot
Disallow: /
User-agent: Download Ninja
Disallow: /
User-agent: Dumbot
Disallow: /
User-agent: EmailCollector
Disallow: /
User-agent: EmailSiphon
Disallow: /
User-agent: EmailWolf
Disallow: /
User-agent: EroCrawler
Disallow: /
User-agent: Euripbot
Disallow: /
User-agent: Exabot
Disallow: /
User-agent: ExtractorPro
Disallow: /
User-agent: FairAd Client
Disallow: /
User-agent: FAST Enterprise Crawler
Disallow: /
User-agent: Fetch
Disallow: /
User-agent: FindLinks
Disallow: /
User-agent: Flaming AttackBot
Disallow: /
User-agent: Foobot
Disallow: /
User-agent: Gaisbot
Disallow: /
User-agent: Generic
Disallow: /
User-agent: Georgios
Disallow: /
User-agent: GetRight
Disallow: /
User-agent: GetRight/4.2
Disallow: /
User-agent: Gigabot
Disallow: /
User-agent: GoForIt
Disallow: /
User-agent: gonzo
Disallow: /
User-agent: gridBOT
Disallow: /
User-agent: grub
Disallow: /
User-agent: grub-client
Disallow: /
User-agent: Harvest
Disallow: /
User-agent: Harvest/1.5
Disallow: /
User-agent: Haste
Disallow: /
User-agent: HenryTheMiragoRobot
Disallow: /
User-agent: Heritrix
Disallow: /
User-agent: hloader
Disallow: /
User-agent: HooWWWer
Disallow: /
User-agent: httplib
Disallow: /
User-agent: HTTrack
Disallow: /
User-agent: humanlinks
Disallow: /
User-agent: ia_archiver
Disallow: /
User-agent: ia_archiver/1.6
Disallow: /
User-agent: iCCrawler
Disallow: /
User-agent: IconSurf
Disallow: /
User-agent: InfoNaviRobot
Disallow: /
User-agent: IRLbot
Disallow: /
User-agent: Iron33
Disallow: /
User-agent: Iron33/1.0.2
Disallow: /
User-agent: IXE Crawler
Disallow: /
User-agent: JemmaTheTourist
Disallow: /
User-agent: JennyBot
Disallow: /
User-agent: Jetbot
Disallow: /
User-agent: Jetbot/1.0
Disallow: /
User-agent: Kenjin Spider
Disallow: /
User-agent: Keyword Density
Disallow: /
User-agent: Keyword Density/0.9
Disallow: /
User-agent: KFSW-Bot
Disallow: /
User-agent: KnowItAll
Disallow: /
User-agent: Lachesis
Disallow: /
User-agent: larbin
Disallow: /
User-agent: LexiBot
Disallow: /
User-agent: libWeb/clsHTTP
Disallow: /
User-agent: libwww
Disallow: /
User-agent: LinkextractorPro
Disallow: /
User-agent: linko
Disallow: /
User-agent: LinkScan
Disallow: /
User-agent: LinkScan/8.1a Unix
Disallow: /
User-agent: LinkWalker
Disallow: /
User-agent: LNSpiderguy
Disallow: /
User-agent: LocalcomBot
Disallow: /
User-agent: looksmart
Disallow: /
User-agent: lwp-trivial
Disallow: /
User-agent: lwp-trivial/1.34
Disallow: /
User-agent: Mata Hari
Disallow: /
User-agent: MentorMate Spider
Disallow: /
User-agent: Microsoft URL Control
Disallow: /
User-agent: Microsoft URL Control - 5.01.4511
Disallow: /
User-agent: Microsoft URL Control - 6.00.8169
Disallow: /
User-agent: MIIxpc
Disallow: /
User-agent: MIIxpc/4.2
Disallow: /
User-agent: mirago
Disallow: /
User-agent: Mister PiX
Disallow: /
User-agent: MMCrawler
Disallow: /
User-agent: moget
Disallow: /
User-agent: moget*
Disallow: /
User-agent: moget/2.1
Disallow: /
User-agent: Molbsy
Disallow: /
User-agent: Moni
Disallow: /
User-agent: Mozilla/4.0 (compatible; BullsEye; Windows 95)
Disallow: /
User-agent: Mozilla/4.0 (compatible; Netcraft Web Server Survey)
Disallow: /
User-agent: MSIECrawler
Disallow: /
User-agent: Muscat Ferret
Disallow: /
User-agent: MyEngines-Bot
Disallow: /
User-agent: NaverBot
Disallow: /
User-agent: Net Attache
Disallow: /
User-agent: NetAnts
Disallow: /
User-agent: NetMechanic
Disallow: /
User-agent: NetResearchServer
Disallow: /
User-agent: NICErsPRO
Disallow: /
User-agent: NimbleCrawler
Disallow: /
User-agent: NPBot
Disallow: /
User-agent: NPT
Disallow: /
User-agent: Nutch
Disallow: /
User-agent: ObjectsSearch
Disallow: /
User-agent: Offline Explorer
Disallow: /
User-agent: Openbot
Disallow: /
User-agent: Openfind
Disallow: /
User-agent: Openfind data gathere
Disallow: /
User-agent: Oracle Ultra Search
Disallow: /
User-agent: penthesilea*
Disallow: /
User-agent: PerMan
Disallow: /
User-agent: PhpDig*
Disallow: /
User-agent: ProPowerBot
Disallow: /
User-agent: ProPowerBot/2.14
Disallow: /
User-agent: ProWebWalker
Disallow: /
User-agent: psbot
Disallow: /
User-agent: Python-urllib
Disallow: /
User-agent: QuepasaCreep
Disallow: /
User-agent: QueryN Metasearch
Disallow: /
User-agent: Radiation Retriever
Disallow: /
User-agent: Radiation Retriever 1.1
Disallow: /
User-agent: RepoMonkey
Disallow: /
User-agent: RepoMonkey Bait & Tackle/v1.01
Disallow: /
User-agent: RepoMonkey*
Disallow: /
User-agent: RMA
Disallow: /
User-agent: RPT-HTTPClient
Disallow: /
User-agent: SBIder
Disallow: /
User-agent: searchpreview
Disallow: /
User-agent: Searchspider
Disallow: /
User-agent: Shim-Crawler
Disallow: /
User-agent: sistrix
Disallow: /
User-agent: sitecheck.internetseer.com
Disallow: /
User-agent: SiteSnagger
Disallow: /
User-agent: Slurp
Disallow: /
User-agent: sna
Disallow: /
User-agent: sohu-search
Disallow: /
User-agent: SpankBot
Disallow: /
User-agent: spanner
Disallow: /
User-agent: Speedy
Disallow: /
User-agent: Spider_ Monkey
Disallow: /
User-agent: SpiderJack
Disallow: /
User-agent: Spinne
Disallow: /
User-agent: stalker
Disallow: /
User-agent: Steeler
Disallow: /
User-agent: SuperGet
Disallow: /
User-agent: suzuran
Disallow: /
User-agent: Szukacz
Disallow: /
User-agent: Szukacz/1.4
Disallow: /
User-agent: TAMU_CS_IRL_CRAWLER
Disallow: /
User-agent: Teleport
Disallow: /
User-agent: Telesoft
Disallow: /
User-agent: The Intraformant
Disallow: /
User-agent: TheNomad
Disallow: /
User-agent: thesubot
Disallow: /
User-agent: toCrawl/UrlDispatcher
Disallow: /
User-agent: True_Robot
Disallow: /
User-agent: True_Robot/1.0
Disallow: /
User-agent: turingos
Disallow: /
User-agent: TutorGig
Disallow: /
User-agent: twiceler
Disallow: /
User-agent: Ultraseek
Disallow: /
User-agent: URL Control
Disallow: /
User-agent: URL_Spider_Pro
Disallow: /
User-agent: URLy Warning
Disallow: /
User-agent: USyd-NLP-Spider
Disallow: /
User-agent: VCI
Disallow: /
User-agent: VCI WebViewer VCI WebViewer Win32
Disallow: /
User-agent: vilainrobot
Disallow: /
User-agent: VIREL
Disallow: /
User-agent: vscooter
Disallow: /
User-agent: VSE/1.0
Disallow: /
User-agent: Web Image Collector
Disallow: /
User-agent: WebAuto
Disallow: /
User-agent: WebBandit
Disallow: /
User-agent: WebBandit/3.50
Disallow: /
User-agent: WebCapture
Disallow: /
User-agent: WebCopier
Disallow: /
User-agent: WebEnhancer
Disallow: /
User-agent: WebmasterWorldForumBot
Disallow: /
User-agent: WebSauger
Disallow: /
User-agent: Website Quester
Disallow: /
User-agent: Webster Pro
Disallow: /
User-agent: WebStripper
Disallow: /
User-agent: Webwhacker
Disallow: /
User-agent: Webzip
Disallow: /
User-agent: WebZip/4.0
Disallow: /
User-agent: Wget
Disallow: /
User-agent: Wget/1.5.3
Disallow: /
User-agent: Wget/1.6
Disallow: /
User-agent: WWW-Collector-E
Disallow: /
User-agent: Xenu's
Disallow: /
User-agent: Xenu's Link Sleuth 1.1c
Disallow: /
User-agent: Yahoo-MMAudVid
Disallow: /
User-agent: Yahoo-MMCrawler
Disallow: /
User-agent: Zao
Disallow: /
User-agent: Zeus
Disallow: /
User-agent: Zeus 32297 Webster Pro V2.9 Win32
Disallow: /
User-agent: Zeus Link Scout
Disallow: /
User-agent: ZipppBo
Disallow: /

Search preview

www.tischtennis.biz
Tischtennis.biz - der TT-Shop mit der guten Beratung
Tischtennisshop für Profi- und Hobby Tischtennis seit 1994. Gerne helfen wir dir bei deiner Auswahl rund um Tischtennis ☎ 0551-5311828

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Tischtennis96%Check
Tischtennis Shop92%Check
Shop88%Check
im Shop67%Check
Tischtennis pur65%Check
Online Shop63%Check
guten Beratung62%Check
Beratung61%Check
guten61%Check
Auswahl56%Check

Test up to 1.000 webpages of tischtennis.biz with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions