Coaching.cards - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
58% 
Page quality
67% 
Page structure
29% 
Link structure
25% 
Server
31% 
External factors
69% 
SEO Score
Response time
1.11 s
File size
253.10 kB
Words
810
Media files
101
Number of links
212 internal / 3 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
COACHING.CARDS – Kreative Coaching Tools – für Business und Persönlichkeit.
The page title should be shorter than 580 pixels. It is 737 pixels long. Optimize title
The domain is used in the page's title.
There are no duplicate words in the title
Meta description
(Critically important)
The meta description is missing.
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://coaching.cards/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de-de
Server location: United States of America
The following language is defined by HTML: de-de
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
No favicon is linked in the HTML code.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no
robotsmax-image-preview:large
generatorPowered by WPBakery Page Builder - drag and drop page builder for WordPress.
frameworkRedux 4.3.7.3
langde-de
charsetUTF-8

Test up to 1.000 webpages of coaching.cards with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
Words from the H1 heading are not used in the page content.
The average number of words per sentence of 9.33 words is low.
This page contains 810 words. That's ok.
21.7% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
The page contains a listing, which indicates a good text layout.
6 paragraphs were found on this page.
No placeholders texts or images were found.
There are no duplicates on the site.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
A viewport "width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=no" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 16 tags for this page.
Image SEO
(Somewhat important)
80 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
...ent/uploads/2021/10/cc_logo-2021mint.pngCOACHING.CARDS
...hemes/savoy/assets/img/[email protected]COACHING.CARDS
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngWERTE.BOX
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngSTÄRKEN.BOX Packshot
.../themes/savoy/assets/img/transparent.gifStärken Karten
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngPerspektivwechsel
.../themes/savoy/assets/img/transparent.gifPerspektivWechsel, Kartensets, COACHING.CARDS
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngKick-Off – Wie Projekte gelingen
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngGedankenspiel
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngPerfekter Tag
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngMindSet
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngMindShift Kartenset
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngGefühle Box Packshot
.../themes/savoy/assets/img/transparent.gifGefühleBox Karten für Coaching und Beratung
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngMarkenworkshop
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngNo alt attribute provided
.../themes/savoy/assets/img/transparent.gifNo alt attribute provided
.../themes/savoy/assets/img/placeholder.pngKlappkarte Sparkle
.../themes/savoy/assets/img/transparent.gifGutschein Sparkle kombo
.../themes/savoy/assets/img/placeholder.pngKlappkarte Glitter
.../themes/savoy/assets/img/transparent.gifGutschein Glitter 2
...ds/2024/07/beatriceselberg-1-300x141.pngNo alt attribute providedbeatriceselberg
...anka.behrami-gedankenspiel_2-300x141.pngNo alt attribute providedbianka.behrami-gedankenspiel_2
...ds/2024/07/Brigitta-Stegherr-300x141.pngNo alt attribute providedBrigitta Stegherr
...ds/2024/07/Catharina_kickoff-300x141.pngNo alt attribute providedCatharina_kickoff
...oads/2024/07/cbb_team_warmup-300x141.pngNo alt attribute providedcbb_team_warmup
...ds/2024/07/entspannungshafen-300x141.pngNo alt attribute providedentspannungshafen
...24/07/frittentini_warmup_013-300x141.pngNo alt attribute providedfrittentini_warmup_013
...oads/2024/07/HenrikeRedecker-300x141.pngNo alt attribute providedHenrikeRedecker
...24/07/Hundesalon-am-Tierpark-300x141.pngNo alt attribute providedHundesalon am Tierpark
...4/07/inkaneugebauer_mws_6123-300x141.pngNo alt attribute providedinkaneugebauer_mws_6123
...ads/2024/07/JensOliverLemmer-300x141.pngNo alt attribute providedJensOliverLemmer
...024/07/Jessica-Teutsch-Kopie-300x141.pngNo alt attribute providedJessica Teutsch Kopie
...ontent/uploads/2024/07/Kunde-300x141.pngNo alt attribute providedKunde
...gasthofseemer_mws_6116-Kopie-300x141.pngNo alt attribute providedlandgasthofseemer_mws_6116-Kopie
...oads/2024/07/marcoport_werte-300x141.pngNo alt attribute providedmarcoport_werte
...oads/2024/07/annlight_werte4-300x141.pngNo alt attribute providedannlight_werte4
...024/07/marcorichter_mws_6105-300x141.pngNo alt attribute providedmarcorichter_mws_6105
...loads/2024/07/Marionstiegler-300x141.pngNo alt attribute providedMarionstiegler
...negger_ko_gi_mws_-1024x460-1-300x141.pngNo alt attribute providedmartinegger_ko_gi_mws_-1024x460
...chael_guteideeko-pe-bundle-2-300x141.pngNo alt attribute providedMichael_guteideeko-pe-bundle-2
...loads/2024/07/mmp_design_MWS-300x141.pngNo alt attribute providedmmp_design_MWS
...07/nati_kle_warmup_012-Kopie-300x141.pngNo alt attribute providednati_kle_warmup_012-Kopie
...karmoewe_deliciense_mws_6122-300x141.pngNo alt attribute providedneckarmoewe_deliciense_mws_6122
...henksystemisch-gdeankenspiel-300x141.pngNo alt attribute providedschenksystemisch-gdeankenspiel
.../07/silviaartmann_warmup_014-300x141.pngNo alt attribute providedsilviaartmann_warmup_014
...arts_IMAGE-2023-05-29-211727-300x141.pngNo alt attribute providedstraussarts_IMAGE-2023-05-29-211727
...7/susanne_goy-gedankenspiel4-300x141.pngNo alt attribute providedsusanne_goy-gedankenspiel4
...tent/uploads/2024/07/Susanne-300x141.pngNo alt attribute providedSusanne
...uploads/2024/07/sweetsystems-300x141.pngNo alt attribute providedsweetsystems
...s/2024/07/thesinman_mws_6119-300x141.pngNo alt attribute providedthesinman_mws_6119
...24/07/thomasdehghan_werte-01-300x141.pngNo alt attribute providedthomasdehghan_werte-01
...uploads/2024/07/WiebkeWimmer-300x141.pngNo alt attribute providedWiebkeWimmer
...ds/2024/07/xxxCoaching-Kopie-300x141.pngNo alt attribute providedxxxCoaching Kopie
...24/07/estermentoringIMG_5067-300x131.pngNo alt attribute providedestermentoringIMG_5067
.../2024/07/katharina-2IMG_5066-300x131.pngNo alt attribute providedkatharina 2IMG_5066
...t/uploads/2024/07/Instastory-300x141.pngNo alt attribute providedInstastory
...2024/07/GuteIdee_wiebkeselma-300x141.pngNo alt attribute providedGuteIdee_wiebkeselma
...t/uploads/2017/01/thorsten-1-200x200.jpgThorsten DiekhofTHORSTEN DIEKHOF
...loads/2023/06/Claudia-Lommel-200x200.jpgClaudia LommelClaudia Lommel

Page structure

H1 heading
(Critically important)
Professionelle Tools für Business und Persönlichkeit. Die Gewinner des Entrepreneurship-Summits.
Too many H1 headings
Headings
(Important)
The structure of headings is missing one or more levels. Do not skip heading levels.
There are 37 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 Professionelle Tools für Business und Persönlichkeit. Die Gewinner des Entrepreneurship-Summits.
H1 Das sagen unsere Kund*innen
H1 Die kreativen Köpfe hinter COACHING.CARDS
H1 Newsletter
H1 KONTAKT
H3 „Einmal alles“ – 16 Kartensets
H3 WERTE.BOX
H3 STÄRKEN.BOX
H3 BEDÜRFNIS.BOX
H3 Professional Bundle – 10 Kartensets
H3 TeamUp! – Frischer Wind für jedes Team
H3 WarmUp! – Impulse für jede Vorstellungsrunde
H3 PerspektivWechsel – für kreatives Brainstorming
H3 COACHES’ TOOLBOX
H3 GuteIdee – Für brillante Ideen & Konzepte
H3 KickOff – Wie Projekte gelingen
H3 GedankenSpiel – Raus aus alten Denkmustern!
H3 Bundle: Persönlichkeitsentwicklung
H3 Perfekter Tag
H3 GetUp! – Powerfragen für Deine Morgenroutine
H3 MindSet – Powerfragen für ein bewusstes & erfülltes Leben
H3 MindShift – Affirmationen für ein erfülltes & erfolgreiches Leben
H3 GEFÜHLE.BOX – Gefühle, Emotionen & Stimmungen erkunden
H3 Bundle: WarmUp! + TeamUp!
H3 KREATIVER MARKENWORKSHOP – Erschaffe eine Marke, die begeistert
H3 Maxiformat: KREATIVER MARKENWORKSHOP
H3 Bundle: GuteIdee + KickOff
H3 CODING.CARDS – Wie gute Software entsteht
H3 GEFÜHLE.BOX – Digital
H3 BEDÜRFNIS.BOX – Digital
H3 STÄRKEN.BOX – Digital
H3 WERTE.BOX – Digital
H3 COACHES’ TOOLBOX – digital
H3 GUTSCHEIN – Motiv “Sparkle”
H3 GUTSCHEIN – Motiv “Glitter”
H5 Trage Dich in unsere E-Mail-Liste ein und erfahre sofort, wenn es neue Produkte, Rabatte und Aktionen für Dich gibt:
H5 Updating…
Some anchor texts are used more than once.
48 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are 3 external links on this page.

Found links on this page

LinkAttributesAnchor text
https://coaching.cards/IMG-ALT COACHING.CARDS
https://www.coaching.cards/shopSubdomain Shop
/produkt/kreativer-markenworks...Kreativer Markenworkshop
/produkt/teamup/Subdomain TeamUp!
/produkt/warmup/WarmUp!
/produkt/perspektivwechsel/Subdomain PerspektivWechsel
/produkt/gute-idee/GuteIdee
/produkt/kickoff/KickOff
/produkt/werte-box/WERTE.BOX
/produkt/staerken-box/STÄRKEN.BOX
/produkt/gefuehle-box/GEFÜHLE.BOX
/produkt/beduerfnis-box/BEDÜRFNIS.BOX
/produkt/gedankenspiel/GedankenSpiel
/produkt/getup/GetUp!
/produkt/perfekter-tag/Erschaffe Deine Vision
/produkt/mindset/MindSet
/produkt/mindshift/MindShift
/produkt/coding-cards/Subdomain CODING.CARDS
/produkt-kategorie/bundle/Bundles
/produkt/bundle-einmal-alles/“Einmal alles”
/produkt/bundle-persoenlichkei...Bundle: Persönlichkeitsentwicklung
/produkt/professional-bundle-8...Professional Bundle
/produkt/coaches-toolbox/COACHES’ TOOLBOX
/produkt/warmup-teamup/WarmUp! + TeamUp!
/produkt/bundle-guteidee-kick/GuteIdee + KickOff
/produkt/coaches-toolbox-digital/COACHES’ TOOLBOX digital
/produkt-kategorie/digitales-p...Digital
/produkt/coaches-toolbox-digital/Text duplicate COACHES’ TOOLBOX digital
/produkt/werte-box-digital/WERTE.BOX – digital
/produkt/gefuehle-box-digital/GEFÜHLE.BOX – digital
/produkt/staerken-box-digital/STÄRKEN.BOX – digital
/produkt/beduerfnis-box-digital/NEU: BEDÜRFNIS.BOX – digital
https://coaching.cards/downloads/Ressourcen
https://coaching.cards/faqs/FAQs
https://www.coaching.cards/Subdomain Anchor Kontakt
/produkt/bundle-einmal-alles/-25%
/produkt/bundle-einmal-alles/„Einmal alles“ – 16 Kartensets
/?add-to-cart=8888Nofollow In den Warenkorb
/produkt/werte-box/Text duplicate IMG-ALT WERTE.BOX
/produkt/werte-box/Text duplicate WERTE.BOX
/?add-to-cart=5552Nofollow Text duplicate In den Warenkorb
/produkt/staerken-box/IMG-ALT STÄRKEN.BOX Packshot
/produkt/staerken-box/Text duplicate STÄRKEN.BOX
/?add-to-cart=17352Nofollow Text duplicate In den Warenkorb
/produkt/beduerfnis-box/No Text
/produkt/beduerfnis-box/Text duplicate BEDÜRFNIS.BOX
/?add-to-cart=27164Nofollow Text duplicate In den Warenkorb
/produkt/professional-bundle-8...-15%
/produkt/professional-bundle-8...Professional Bundle – 10 Kartensets
/?add-to-cart=9340Nofollow Text duplicate In den Warenkorb
/produkt/teamup/No Text
/produkt/teamup/TeamUp! – Frischer Wind für jedes Team
/?add-to-cart=12Nofollow Text duplicate In den Warenkorb
/produkt/warmup/No Text
/produkt/warmup/WarmUp! – Impulse für jede Vorstellungsrunde
/?add-to-cart=1051Nofollow Text duplicate In den Warenkorb
/produkt/perspektivwechsel/IMG-ALT Perspektivwechsel
/produkt/perspektivwechsel/PerspektivWechsel – für kreatives Brainstorming
/?add-to-cart=874Nofollow Text duplicate In den Warenkorb
/produkt/coaches-toolbox/-20%
/produkt/coaches-toolbox/Text duplicate COACHES’ TOOLBOX
/?add-to-cart=18374Nofollow Text duplicate In den Warenkorb
/produkt/gute-idee/No Text
/produkt/gute-idee/GuteIdee – Für brillante Ideen & Konzepte
/?add-to-cart=5999Nofollow Text duplicate In den Warenkorb
/produkt/kickoff/IMG-ALT Kick-Off – Wie Projekte gelingen
/produkt/kickoff/KickOff – Wie Projekte gelingen
/?add-to-cart=7926Nofollow Text duplicate In den Warenkorb
/produkt/gedankenspiel/IMG-ALT Gedankenspiel
/produkt/gedankenspiel/GedankenSpiel – Raus aus alten Denkmustern!
/?add-to-cart=16061Nofollow Text duplicate In den Warenkorb
/produkt/bundle-persoenlichkei...-24%
/produkt/bundle-persoenlichkei...Text duplicate Bundle: Persönlichkeitsentwicklung
/?add-to-cart=8972Nofollow Text duplicate In den Warenkorb
/produkt/perfekter-tag/IMG-ALT Perfekter Tag
/produkt/perfekter-tag/Text duplicate Perfekter Tag
/?add-to-cart=8103Nofollow Text duplicate In den Warenkorb
/produkt/getup/No Text
/produkt/getup/GetUp! – Powerfragen für Deine Morgenroutine
/?add-to-cart=8269Nofollow Text duplicate In den Warenkorb
/produkt/mindset/Text duplicate IMG-ALT MindSet
/produkt/mindset/MindSet – Powerfragen für ein bewusstes & erfülltes Leben
/?add-to-cart=7921Nofollow Text duplicate In den Warenkorb
/produkt/mindshift/IMG-ALT MindShift Kartenset
/produkt/mindshift/MindShift – Affirmationen für ein erfülltes & erfolgreiches Leben
/?add-to-cart=8094Nofollow Text duplicate In den Warenkorb
/produkt/gefuehle-box/IMG-ALT Gefühle Box Packshot
/produkt/gefuehle-box/GEFÜHLE.BOX – Gefühle, Emotionen & Stimmungen erkunden
/?add-to-cart=17351Nofollow Text duplicate In den Warenkorb
/produkt/warmup-teamup/-10%
/produkt/warmup-teamup/Bundle: WarmUp! + TeamUp!
/?add-to-cart=4338Nofollow Text duplicate In den Warenkorb
/produkt/kreativer-markenworks...IMG-ALT Markenworkshop
/produkt/kreativer-markenworks...KREATIVER MARKENWORKSHOP – Erschaffe eine Marke, die begeistert
/?add-to-cart=30073Nofollow Text duplicate In den Warenkorb
/produkt/kreativer-markenworks...No Text
/produkt/kreativer-markenworks...Maxiformat: KREATIVER MARKENWORKSHOP
/produkt/kreativer-markenworks...Nofollow Trivial anchor text
Weiterlesen
/produkt/bundle-guteidee-kick/Text duplicate -10%
/produkt/bundle-guteidee-kick/Bundle: GuteIdee + KickOff
/?add-to-cart=9103Nofollow Text duplicate In den Warenkorb
/produkt/coding-cards/No Text
/produkt/coding-cards/CODING.CARDS – Wie gute Software entsteht
/?add-to-cart=875Nofollow Text duplicate In den Warenkorb
/produkt/gefuehle-box-digital/No Text
/produkt/gefuehle-box-digital/GEFÜHLE.BOX – Digital
/?add-to-cart=19820Nofollow Text duplicate In den Warenkorb
/produkt/beduerfnis-box-digital/No Text
/produkt/beduerfnis-box-digital/BEDÜRFNIS.BOX – Digital
/?add-to-cart=22072Nofollow Text duplicate In den Warenkorb
/produkt/staerken-box-digital/No Text
/produkt/staerken-box-digital/STÄRKEN.BOX – Digital
/?add-to-cart=19798Nofollow Text duplicate In den Warenkorb
/produkt/werte-box-digital/No Text
/produkt/werte-box-digital/WERTE.BOX – Digital
/?add-to-cart=19639Nofollow Text duplicate In den Warenkorb
/produkt/coaches-toolbox-digital/-33%
/produkt/coaches-toolbox-digital/COACHES’ TOOLBOX – digital
/?add-to-cart=19853Nofollow Text duplicate In den Warenkorb
/produkt/gutschein/IMG-ALT Klappkarte Sparkle
/produkt/gutschein/GUTSCHEIN – Motiv “Sparkle”
/produkt/gutschein/Nofollow Ausführung wählen
/produkt/gutschein-motiv-glitter/IMG-ALT Klappkarte Glitter
/produkt/gutschein-motiv-glitter/GUTSCHEIN – Motiv “Glitter”
/produkt/gutschein-motiv-glitter/Nofollow Text duplicate Ausführung wählen
/wp-content/uploads/2024/07/be...No Text
/wp-content/uploads/2024/07/bi...No Text
/wp-content/uploads/2024/07/Br...No Text
/wp-content/uploads/2024/07/Ca...No Text
/wp-content/uploads/2024/07/cb...No Text
/wp-content/uploads/2024/07/en...No Text
/wp-content/uploads/2024/07/fr...No Text
/wp-content/uploads/2024/07/He...No Text
/wp-content/uploads/2024/07/Hu...No Text
/wp-content/uploads/2024/07/in...No Text
/wp-content/uploads/2024/07/Je...No Text
/wp-content/uploads/2024/07/Je...No Text
/wp-content/uploads/2024/07/Ku...No Text
/wp-content/uploads/2024/07/la...No Text
/wp-content/uploads/2024/07/ma...No Text
/wp-content/uploads/2024/07/an...No Text
/wp-content/uploads/2024/07/ma...No Text
/wp-content/uploads/2024/07/Ma...No Text
/wp-content/uploads/2024/07/ma...No Text
/wp-content/uploads/2024/07/Mi...No Text
/wp-content/uploads/2024/07/mm...No Text
/wp-content/uploads/2024/07/na...No Text
/wp-content/uploads/2024/07/ne...No Text
/wp-content/uploads/2024/07/sc...No Text
/wp-content/uploads/2024/07/si...No Text
/wp-content/uploads/2024/07/st...No Text
/wp-content/uploads/2024/07/su...No Text
/wp-content/uploads/2024/07/Su...No Text
/wp-content/uploads/2024/07/sw...No Text
/wp-content/uploads/2024/07/th...No Text
/wp-content/uploads/2024/07/th...No Text
/wp-content/uploads/2024/07/Wi...No Text
/wp-content/uploads/2024/07/xx...No Text
/wp-content/uploads/2024/07/es...No Text
/wp-content/uploads/2024/07/ka...No Text
/wp-content/uploads/2024/07/In...No Text
/wp-content/uploads/2024/07/Gu...No Text
/datenschutzbelehrung/Subdomain Datenschutz
https://www.coaching.cards/faqs/Subdomain FAQ
/datenschutzbelehrung/Subdomain Text duplicate Datenschutz
https://coaching.cards/Startseite
https://coaching.cards/shop/Text duplicate Shop
https://coaching.cards/impressum/Impressum
https://coaching.cards/agb/Allgemeine Geschäftsbedingungen
/datenschutzbelehrung/Text duplicate Datenschutz
https://coaching.cards/widerruf/Widerruf
/bestellvorgang/Bestellvorgang
/versand__lieferung/Versand & Lieferung
/zahlungsweisen/Zahlungsweisen
https://coaching.cards/faqs/Text duplicate FAQs
https://www.coaching.cards/Subdomain Anchor Text duplicate Kontakt
https://www.facebook.com/New window Nofollow External Subdomain A-TITLE Facebook
https://www.instagram.com/New window Nofollow External Subdomain A-TITLE Instagram
https://www.twitter.com/New window Nofollow External Subdomain A-TITLE Twitter
https://www.coaching.cards/shopSubdomain Text duplicate Shop
/produkt/kreativer-markenworks...Text duplicate Kreativer Markenworkshop
/produkt/teamup/Subdomain Text duplicate TeamUp!
/produkt/warmup/Text duplicate WarmUp!
/produkt/perspektivwechsel/Subdomain Text duplicate PerspektivWechsel
/produkt/gute-idee/Text duplicate GuteIdee
/produkt/kickoff/Text duplicate KickOff
/produkt/werte-box/Text duplicate WERTE.BOX
/produkt/staerken-box/Text duplicate STÄRKEN.BOX
/produkt/gefuehle-box/Text duplicate GEFÜHLE.BOX
/produkt/beduerfnis-box/Text duplicate BEDÜRFNIS.BOX
/produkt/gedankenspiel/Text duplicate GedankenSpiel
/produkt/getup/Text duplicate GetUp!
/produkt/perfekter-tag/Text duplicate Erschaffe Deine Vision
/produkt/mindset/Text duplicate MindSet
/produkt/mindshift/Text duplicate MindShift
/produkt/coding-cards/Subdomain Text duplicate CODING.CARDS
/produkt-kategorie/bundle/Text duplicate Bundles
/produkt/bundle-einmal-alles/Text duplicate “Einmal alles”
/produkt/bundle-persoenlichkei...Text duplicate Bundle: Persönlichkeitsentwicklung
/produkt/professional-bundle-8...Text duplicate Professional Bundle
/produkt/coaches-toolbox/Text duplicate COACHES’ TOOLBOX
/produkt/warmup-teamup/Text duplicate WarmUp! + TeamUp!
/produkt/bundle-guteidee-kick/Text duplicate GuteIdee + KickOff
/produkt/coaches-toolbox-digital/Text duplicate COACHES’ TOOLBOX digital
/produkt-kategorie/digitales-p...Text duplicate Digital
/produkt/coaches-toolbox-digital/Text duplicate COACHES’ TOOLBOX digital
/produkt/werte-box-digital/Text duplicate WERTE.BOX – digital
/produkt/gefuehle-box-digital/Text duplicate GEFÜHLE.BOX – digital
/produkt/staerken-box-digital/Text duplicate STÄRKEN.BOX – digital
/produkt/beduerfnis-box-digital/Text duplicate NEU: BEDÜRFNIS.BOX – digital
https://coaching.cards/downloads/Text duplicate Ressourcen
https://coaching.cards/faqs/Text duplicate FAQs
https://www.coaching.cards/Subdomain Anchor Text duplicate Kontakt
https://coaching.cards/cart/Warenkorb 0
https://coaching.cards/shop/Weiter einkaufen

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://coaching.cards/"
HTTP header
(Important)
The HTML page should be transferred using GZip compression.
No X-Powered HTTP header is sent.
Performance
(Somewhat important)
The page response time is slow (1.11 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
The file size of the HTML document is fine (253 kB).

HTTP Response Header

NameValue
link<https://coaching.cards/wp-json/>; rel="https://api.w.org/", <https://coaching.cards/wp-json/wp/v2/pages/757>; rel="alternate"; type="application/json", <https://coaching.cards/>; rel=shortlink
content-typetext/html; charset=UTF-8
dateSat, 28 Sep 2024 20:08:52 GMT
serverApache
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Nice to have)
This website is not classified "for adult only".
This page has only a few links from other websites.
This page only has backlinks from 20 referring domains.
This page only has 50 backlinks.
This page only has few backlinks from 20 different ip addresses.
Facebook popularity
(Somewhat important)
The page has 0 shares and comments on Facebook.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

User-agent: *
Disallow: /wp-admin/
Allow: /wp-admin/admin-ajax.php

Sitemap: https://coaching.cards/wp-sitemap.xml

Disallow: /wp-content/uploads/wpo-plugins-tables-list.json

Similar sites

Search preview

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
CARDS70%Check
Coaching68%Check
Persönlichkeit65%Check
Tools62%Check
Business61%Check
NEU58%Check
EUR55%Check
COACHING.CARDS Kreative Coaching Tools51%Check
Professionelle50%Check
Gewinner50%Check
Show more keywords and terms

Test up to 1.000 webpages of coaching.cards with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions