De.eucerin.ch - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
79% 
Page quality
28% 
Page structure
100% 
Link structure
26% 
Server
71% 
External factors
100% 
SEO Score
Response time
0.88 s
File size
640.40 kB
Words
622
Media files
21
Number of links
149 internal / 4 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Dermokosmetik und Hautwissen von Eucerin
The length of the page title is perfect. (402 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Seit über 100 Jahren ist Eucerin wegweisend in innovativer kosmetischer Hautforschung und anerkannt als eine der führenden, vertrauenswürdigen Hautpflegemarken. Eucerin Produkte helfen, das Hautgefühl zu verbessern. Tag für Tag empfehlen Dermatologen und Apotheker in aller Welt Eucerin. Geniessen Sie das Selbstvertrauen, das gesunde, strahlend schöne Haut Ihnen verleiht.
The meta description is too long: 2386 pixels from max. 1000 pixels. Optimize description
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.de.eucerin.ch/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de-ch
Server location: United States of America
The following language is defined by HTML: de-ch
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
This page is hosted on a subdomain. Use a top level domain for better SEO results.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0
keywordsEucerin, Hautpflege, gesunde Haut, Hautproblem, Produkte von Eucerin
descriptionSeit über 100 Jahren ist Eucerin wegweisend in innovativer kosmetischer Hautforschung und anerkannt als eine der führenden, vertrauenswürdigen Hautpflegemarken. Eucerin Produkte helfen, das Hautgefühl zu verbessern. Tag für Tag empfehlen Dermatologen und Apotheker in aller Welt Eucerin. Geniessen Sie das Selbstvertrauen, das gesunde, strahlend schöne Haut Ihnen verleiht.
google-site-verification-S8zKNhBfQrifEJeU_qgRIw98eJjqlObTvJZZFYlKbo
langde-ch
og:titleDermokosmetik und Hautwissen von Eucerin
og:descriptionSeit über 100 Jahren ist Eucerin wegweisend in innovativer kosmetischer Hautforschung und anerkannt als eine der führenden, vertrauenswürdigen Hautpflegemarken. Eucerin Produkte helfen, das Hautgefühl zu verbessern. Tag für Tag empfehlen Dermatologen und Apotheker in aller Welt Eucerin. Geniessen Sie das Selbstvertrauen, das gesunde, strahlend schöne Haut Ihnen verleiht.
og:typewebsite
og:urlhttps://www.de.eucerin.ch/
charsetutf-8

Test up to 1.000 webpages of de.eucerin.ch with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
Some words from the page title are not used within the pages content
Words from the H1 heading are not used in the page content.
No paragraphs were detected.
This page contains 622 words. That's ok.
24.3% of the text are stop words.
The page contains a listing, which indicates a good text layout.
No placeholders texts or images were found.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
The file size of the HTML document is very large (640.4 kB).
A viewport "width=device-width, initial-scale=1.0" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 12 tags for this page.
Image SEO
(Somewhat important)
16 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
...40&hash=BEF8B65DA80668AA8F62DAB6CDE5F0D4No alt attribute provided
...00&hash=55788BC3C241C2B7BD709D692BF43C2ASerum gegen Pigmentflecken von Eucerin
...25&hash=6AF2752A4CB6F8170C3BA36F719E1ED8No alt attribute provided
...40&hash=BEF8B65DA80668AA8F62DAB6CDE5F0D4No alt attribute provided
...00&hash=55788BC3C241C2B7BD709D692BF43C2ASerum gegen Pigmentflecken von Eucerin
...25&hash=6AF2752A4CB6F8170C3BA36F719E1ED8No alt attribute provided
...20&hash=80559F7C43D31941C867A1BA715C653DNo alt attribute provided
...40&hash=941406D24F18D805366B233132A29B9ENo alt attribute provided
...40&hash=BEF8B65DA80668AA8F62DAB6CDE5F0D4No alt attribute provided
...00&hash=55788BC3C241C2B7BD709D692BF43C2ASerum gegen Pigmentflecken von Eucerin
...40&hash=D95C826D5CD486A5CF9BA7D4A1598A7BNo alt attribute provided
...00&hash=28EE987AE91A92F5D73A0F06AAA98DC6No alt attribute provided
...00&hash=B6361FC107C2DFF63A2298965BA66C30No alt attribute provided
...00&hash=BC8C28963D394AA3E0F505B3FE2B6E65Frau kratzt sich die juckende und trockene Kopfhaut
...40&hash=BEF8B65DA80668AA8F62DAB6CDE5F0D4No alt attribute provided
...40&hash=830E8EE6D0CD91B9EED622EA1E3FA031No alt attribute provided
...40&hash=4F3A31084E88955ED77C3A6B58E3A4E3No alt attribute provided
...40&hash=29DBDAE108445018761E162235695F08No alt attribute provided
...ab4e0dbac498a902b865a4bcdcb69-screen.jpgNo alt attribute provided
...der/pharmacyfinder_static_bg_desktop.pngNo alt attribute provided
...55&hash=1AC9967AE3B4D2414D6C4348EF29DE87

Page structure

H1 heading
(Critically important)
Ultraleichte Textur mit Lichtschutz 50+
The H1 heading is perfect.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 Ultraleichte Textur mit Lichtschutz 50+
H2 Entdecke Eucerin
H2 Beliebte Artikel
H2 Beliebte Produkte
H2 Jetzt zum Newsletter anmelden!
H2 Händlersuche
Some internal link anchor texts are too long.
Some internal links have dynamic parameters. All internal URLs, which are not marked as nofollow, should not contain dynamic parameters.
Some anchor texts are used more than once.
The number of internal links is ok.
There are 4 external links on this page.

Found links on this page

LinkAttributesAnchor text
https://www.de.eucerin.ch/No Text
/produkte/hyaluron-filler-elas...Alternde Haut Sonnenschutz pigmentflecken-hyperpigmentierung Verlust von Elastizität und tiefe Falten HYALURON-FILLER + ELASTICITY Nachtpflege 50 ml Online b...
/produkte/anti-pigment/dual-se...Unebenmässiger Teint Hyperpigmentierung Anti-Pigment Double Serum 30 ml 4.3 25 Bewertungen Online bestellen
IMG-ALT Serum gegen Pigmentflecken von Eucerin
/produkte/sonnenschutz/eucerin...LSF 50+ Sonnenschutz Für alle Hauttypen geeiegnet Eucerin Sun Body Oil Control Gel-Cream LSF 50+​ 50 ML 3.0 2 Bewertungen Online bestellen
/produkteAlle Produkte ansehen
https://www.de.eucerin.ch/No Text
/produkteProdukte
/produkteHautzustand
/produkte/alternde-hautAlternde Haut
/produkte/empfindliche-hautEmpfindliche Haut
/produkte/kopfhaut-und-haarpro...Kopfhaut- und Haarprobleme
/produkte/sonnenschutzSonnenschutz
/produkte/trockene-hautTrockene Haut
/produkteÜberempfindliche, zu Rötungen neigende Haut
/produkte/unebenmaessiger-teintUnebenmässiger Teint
/produkte/zu-unreinheiten-neig...Zu Unreinheiten neigende Haut
/produkteAlle Pflegeserien
/produkteText duplicate Alle Pflegeserien
/produkte/anti-pigmentAnti-Pigment
/produkte/aquaphorAquaphor Schutz- & Pflegesalbe
/produkte/atocontrolAtoControl
/produkte/dermato-cleanDermatoCLEAN [HYALURON]
/produkte/dermocapillaireDermoCapillaire
/produkte/dermo-pureDermoPure
/produkte/hyaluron-filler-3x-e...Hyaluron-Filler + 3x Effect
/produkte/hyaluron-filler-elas...Hyaluron-Filler + Elasticity
/produkte/hyaluron-filler-ureaHyaluron-Filler + Urea
/produkte/hyaluron-filler-volu...Hyaluron-Filler + Volume-Lift
/produkte/ph5-hautpH5
/produkte/sonnenschutzSUN
/produkte/ueberempfindliche-hautUltra Sensitive + Anti Rötungen
/produkte/urea-repairUreaRepair PLUS
/produkteText duplicate Alle Pflegeserien
/hautzustandBeratung
/hautzustandText duplicate Hautzustand
/hautzustand/zu-unreinheiten-n...Unreine, zu Akne neigende Haut
/hautzustand/alternde-hautText duplicate Alternde Haut
/hautzustand/neurodermitisNeurodermitis
/hautzustand/trockene-hautText duplicate Trockene Haut
/hautzustand/ueberempfindliche...Text duplicate Überempfindliche, zu Rötungen neigende Haut
/hautzustand/kopfhaut-und-haar...Text duplicate Kopfhaut- und Haarprobleme
/hautzustand/empfindliche-hautText duplicate Empfindliche Haut
/hautzustand/sonnenschutzText duplicate Sonnenschutz
/hautzustand/unebenmaessiger-t...Pigmentflecken
/hautzustandText duplicate Beratung
/ueber-die-hautÜber die Haut
/ueber-die-haut/die-haut-grund...Die Haut: Grundlagen
/ueber-die-haut/hautbehandlungHautbehandlung
/ueber-die-haut/richtig-haende...Händedesinfektion und Händewaschen zum Schutz vor Infektionen
/hautzustandText duplicate Beratung
/unsere-forschung/aus-der-fors...Unsere Forschung
/unsere-forschung/forschungshi...Forschungshintergrund
/unsere-forschung/datenbank-fu...Datenbank für Inhaltsstoffe
/ueber-eucerinÜber Eucerin
/ueber-eucerin/krebsligaKrebsliga
/sustainability-and-responsibi...Nachhaltigkeit
/nachhaltigkeit/hochwertige-in...Mikroplastik in Pflegeprodukten
/nachhaltigkeit/hochwertige-in...Die Ocean Formula
/nachhaltigkeit/hochwertige-in...Nutzung hochwertiger Rohstoffe
/nachhaltigkeit/hochwertige-in...Eucerin gegen Tierversuche
/produkteText duplicate Produkte
/produkteText duplicate Produkte
/produkteText duplicate Hautzustand
/produkteText duplicate Hautzustand
/produkte/alternde-hautText duplicate Alternde Haut
/produkte/empfindliche-hautText duplicate Empfindliche Haut
/produkte/kopfhaut-und-haarpro...Text duplicate Kopfhaut- und Haarprobleme
/produkte/sonnenschutzText duplicate Sonnenschutz
/produkte/trockene-hautText duplicate Trockene Haut
/produkteText duplicate Überempfindliche, zu Rötungen neigende Haut
/produkte/unebenmaessiger-teintText duplicate Unebenmässiger Teint
/produkte/zu-unreinheiten-neig...Text duplicate Zu Unreinheiten neigende Haut
/produkteText duplicate Alle Pflegeserien
/produkteText duplicate Alle Pflegeserien
/produkteText duplicate Alle Pflegeserien
/produkte/anti-pigmentText duplicate Anti-Pigment
/produkte/aquaphorText duplicate Aquaphor Schutz- & Pflegesalbe
/produkte/atocontrolText duplicate AtoControl
/produkte/dermato-cleanText duplicate DermatoCLEAN [HYALURON]
/produkte/dermocapillaireText duplicate DermoCapillaire
/produkte/dermo-pureText duplicate DermoPure
/produkte/hyaluron-filler-3x-e...Text duplicate Hyaluron-Filler + 3x Effect
/produkte/hyaluron-filler-elas...Text duplicate Hyaluron-Filler + Elasticity
/produkte/hyaluron-filler-ureaText duplicate Hyaluron-Filler + Urea
/produkte/hyaluron-filler-volu...Text duplicate Hyaluron-Filler + Volume-Lift
/produkte/ph5-hautText duplicate pH5
/produkte/sonnenschutzText duplicate SUN
/produkte/ueberempfindliche-hautText duplicate Ultra Sensitive + Anti Rötungen
/produkte/urea-repairText duplicate UreaRepair PLUS
/produkteText duplicate Alle Pflegeserien
/hautzustandText duplicate Beratung
/hautzustandText duplicate Beratung
/hautzustandText duplicate Hautzustand
/hautzustandText duplicate Hautzustand
/hautzustand/zu-unreinheiten-n...Text duplicate Unreine, zu Akne neigende Haut
/hautzustand/alternde-hautText duplicate Alternde Haut
/hautzustand/neurodermitisText duplicate Neurodermitis
/hautzustand/trockene-hautText duplicate Trockene Haut
/hautzustand/ueberempfindliche...Text duplicate Überempfindliche, zu Rötungen neigende Haut
/hautzustand/kopfhaut-und-haar...Text duplicate Kopfhaut- und Haarprobleme
/hautzustand/empfindliche-hautText duplicate Empfindliche Haut
/hautzustand/sonnenschutzText duplicate Sonnenschutz
/hautzustand/unebenmaessiger-t...Text duplicate Pigmentflecken
/hautzustandText duplicate Beratung
/ueber-die-hautText duplicate Über die Haut
/ueber-die-hautText duplicate Über die Haut
/ueber-die-haut/die-haut-grund...Text duplicate Die Haut: Grundlagen
/ueber-die-haut/hautbehandlungText duplicate Hautbehandlung
/ueber-die-haut/richtig-haende...Text duplicate Händedesinfektion und Händewaschen zum Schutz vor Infektionen
/hautzustandText duplicate Beratung
/unsere-forschung/aus-der-fors...Text duplicate Unsere Forschung
/unsere-forschung/aus-der-fors...Text duplicate Unsere Forschung
/unsere-forschung/forschungshi...Text duplicate Forschungshintergrund
/unsere-forschung/datenbank-fu...Text duplicate Datenbank für Inhaltsstoffe
/ueber-eucerinText duplicate Über Eucerin
/ueber-eucerinText duplicate Über Eucerin
/ueber-eucerin/krebsligaText duplicate Krebsliga
/sustainability-and-responsibi...Text duplicate Nachhaltigkeit
/sustainability-and-responsibi...Text duplicate Nachhaltigkeit
/nachhaltigkeit/hochwertige-in...Text duplicate Mikroplastik in Pflegeprodukten
/nachhaltigkeit/hochwertige-in...Text duplicate Die Ocean Formula
/nachhaltigkeit/hochwertige-in...Text duplicate Nutzung hochwertiger Rohstoffe
/nachhaltigkeit/hochwertige-in...Text duplicate Eucerin gegen Tierversuche
/produkte/hyaluron-filler-elas...Text duplicate Alternde Haut Sonnenschutz pigmentflecken-hyperpigmentierung Verlust von Elastizität und tiefe Falten HYALURON-FILLER + ELASTICITY Nachtpflege 50 ml Online b...
/produkte/anti-pigment/dual-se...Text duplicate Unebenmässiger Teint Hyperpigmentierung Anti-Pigment Double Serum 30 ml 4.3 25 Bewertungen Online bestellen
IMG-ALT Serum gegen Pigmentflecken von Eucerin
/produkte/sonnenschutz/eucerin...Text duplicate LSF 50+ Sonnenschutz Für alle Hauttypen geeiegnet Eucerin Sun Body Oil Control Gel-Cream LSF 50+​ 50 ML 3.0 2 Bewertungen Online bestellen
/produkteText duplicate Alle Produkte ansehen
/produkte/sonnenschutz/hydro-p...JETZT ENTDECKEN
/produkte/hyaluron-filler/tage...LSF 15 Alternde Haut Falten HYALURON-FILLER Tagespflege für trockene Haut 50 ml Online bestellen
/produkte/hyaluron-filler-elas...Text duplicate Alternde Haut Sonnenschutz pigmentflecken-hyperpigmentierung Verlust von Elastizität und tiefe Falten HYALURON-FILLER + ELASTICITY Nachtpflege 50 ml Online b...
/produkte/anti-pigment/dual-se...Text duplicate Unebenmässiger Teint Hyperpigmentierung Anti-Pigment Double Serum 30 ml 4.3 25 Bewertungen Online bestellen
IMG-ALT Serum gegen Pigmentflecken von Eucerin
/produkte/urea-repair/plus-lot...Trockene Haut Bei sehr trockener, rauer und gespannter Haut UreaRepair PLUS Lotion 10% Urea 400 ml 4.3 4 Bewertungen Online bestellen
/produkteEntdecken Sie unsere Produktserien
/hautzustand/alternde-haut/faltenWas kann ich gegen Fältchen und Falten auf der Stirn und um Mund und Augen tun? 5 min Lesezeit
/hautzustand/pigmentflecken/hy...Hyperpigmentierung Erfahren Sie mehr über die Ursachen und Lösungen der Hyperpigmentierung. 6 min Lesezeit
/hautzustand/kopfhaut-und-haar...Trockene und juckende Kopfhaut Verstehen Sie die Ursachen für trockene und juckende Kopfhaut und finden Sie eine Lösung 6 min Lesezeit
IMG-ALT Frau kratzt sich die juckende und trockene Kopfhaut
/sustainability-and-responsibi...Entdecke unseren Nachhaltigkeitsansatz
/produkte/hyaluron-filler-elas...Text duplicate Alternde Haut Sonnenschutz pigmentflecken-hyperpigmentierung Verlust von Elastizität und tiefe Falten HYALURON-FILLER + ELASTICITY Nachtpflege 50 ml Online b...
/produkte/hyaluron-filler-elas...LSF 15 Alternde Haut Sonnenschutz pigmentflecken-hyperpigmentierung Verlust von Elastizität und tiefe Falten Hyaluron-Filler + Elasticity Tagespflege LSF 15 ...
/produkte/hyaluron-filler-3x-e...LSF 15 Alternde Haut Falten HYALURON-FILLER Augenpflege 15 ml Online bestellen
/produkte/hyaluron-filler/nach...Alternde Haut Falten HYALURON-FILLER Nachtpflege 50 ml 4.3 7 Bewertungen Online bestellen
/produkteText duplicate Entdecken Sie unsere Produktserien
/meta-seiten/newsletterAnmelden
https://www.de.eucerin.ch/Anchor No Text
https://www.facebook.com/eucer...New window External Subdomain No Text
https://www.youtube.com/channe...New window External Subdomain No Text
https://www.instagram.com/euce...New window External Subdomain No Text
/meta-seiten/impressumImpressum
/meta-seiten/datenschutzerklarungDATENSCHUTZERKLÄRUNG -
/meta-seiten/nutzungsbedingungenNutzungsbedingungen
/?cmpscreencustomSubdomain COOKIES EINSTELLUNGEN
/meta-seiten/kontaktKontaktiere uns
https://www.de.beiersdorf.ch/k...External Subdomain KARRIERE

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.de.eucerin.ch/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time of 0.88 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is very large (640 kB).

HTTP Response Header

NameValue
dateSat, 20 Jul 2024 13:25:08 GMT
content-typetext/html; charset=utf-8
varyAccept-Encoding
cache-controlno-cache, no-store
pragmano-cache
expires-1
x-frame-optionsSAMEORIGIN
set-cookie44 Characters
x-azure-ref20240720T132508Z-16b8f8f97cf8hg2catkf8c6pu8000000026g00000000rtys
x-fd-int-roxy-purgeid66725982
x-cachePRIVATE_NOSTORE
content-security-policydefault-src https: 'unsafe-inline' 'unsafe-eval' wss://umd.userlike.com wss://ws.botmaker.com; worker-src blob:; img-src 'self' blob: data: https:; font-src 'self' data: https:
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Nice to have)
This website is not classified "for adult only".
This website has excellent links from other websites.
This page has backlinks from 149 referring domains.
This page has 1,371 backlinks.
This page has backlinks from 123 different ip addresses.
Facebook popularity
(Somewhat important)
The page has 0 shares and comments on Facebook.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

User-agent: * 
Sitemap: https://www.de.eucerin.ch/sitemap

Disallow: /sitecore/*
Disallow: /components/*
Disallow: /meta-seiten/search?*
Disallow: /meta-seiten/search-result-page?*
Disallow: /ajax_eucerin/*
Disallow: /ajax_eucerin_legacy/*

Similar sites

Search preview

www.de.eucerin.ch
Dermokosmetik und Hautwissen von Eucerin
Seit über 100 Jahren ist Eucerin wegweisend in innovativer kosmetischer Hautforschung und anerkannt als eine der führenden, vertrauenswürdigen Hautpflegemarken. Eucerin Produkte helfen, das Hautgefühl zu verbessern. Tag für Tag empfehlen Dermatologen und Apotheker in aller Welt Eucerin. Geniessen Sie das Selbstvertrauen, das gesunde, strahlend schöne Haut Ihnen verleiht.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Eucerin76%Check
Produkte50%Check
Schutz50%Check
Ultra50%Check
Ultraleichte50%Check
Textur50%Check
Lichtschutz50%Check
sun48%Check
Tag48%Check
Forschung46%Check
Show more keywords and terms

Test up to 1.000 webpages of de.eucerin.ch with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions