Wallee.com - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
77% 
Page quality
66% 
Page structure
38% 
Link structure
37% 
Server
95% 
External factors
100% 
SEO Score
Response time
1.97 s
File size
130.40 kB
Words
2328
Media files
75
Number of links
143 internal / 43 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
wallee | Moderne Zahlungsmethoden auf jedem Kanal
The length of the page title is perfect. (483 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Easy pay any way. Ob moderne Zahlungsmethoden im Internet, Kartenzahlungen im Geschäft oder die Verarbeitung von Zahlungen an Automaten. Entdecken Sie die vielfältigen Möglichkeiten mit wallee.
The meta description is too long: 1250 pixels from max. 1000 pixels. Optimize description
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
No canonical link is specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de
Server location: United States of America
The following language is defined by HTML: de
Alternate/Hreflang Links
(Somewhat important)
The alternate link to the page itself is missing.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The character encoding is not specified in the HTTP header.
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
descriptionEasy pay any way. Ob moderne Zahlungsmethoden im Internet, Kartenzahlungen im Geschäft oder die Verarbeitung von Zahlungen an Automaten. Entdecken Sie die vielfältigen Möglichkeiten mit wallee.
viewportwidth=device-width, initial-scale=1
facebook-domain-verificationtto3jlxlg51ogx2poa64lbg20wmeyn
langde
twitter:cardsummary_large_image
twitter:titlewallee | Moderne Zahlungsmethoden auf jedem Kanal
twitter:descriptionEasy pay any way. Ob moderne Zahlungsmethoden im Internet, Kartenzahlungen im Geschäft oder die Verarbeitung von Zahlungen an Automaten. Entdecken Sie die vielfältigen Möglichkeiten mit wallee.
og:titlewallee | Moderne Zahlungsmethoden auf jedem Kanal
og:descriptionEasy pay any way. Ob moderne Zahlungsmethoden im Internet, Kartenzahlungen im Geschäft oder die Verarbeitung von Zahlungen an Automaten. Entdecken Sie die vielfältigen Möglichkeiten mit wallee.
og:typewebsite
charsetutf-8

Test up to 1.000 webpages of wallee.com with our free plan!

Try For Free
No trial. It's just free!

Page quality

Content
(Critically important)
Some words from the page title are not used within the pages content
These Typos were found:
  • mordernen => modernen
  • grosse => große
Placeholders texts or images were found.
  • Filler text: Lorem ipsum dolor sit amet consectetur adipiscing elit Suspendisse var...
This page contains 2328 words. That's ok.
36.7% of the text are stop words.
The page contains a listing, which indicates a good text layout.
36 paragraphs were found on this page.
There are no duplicates on the site.
The average number of words per sentence of 13.16 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The following tag is repeated too often: sie haben fragen?
Image SEO
(Somewhat important)
33 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
...c566753b08_wallee_logo_RGB_turquoise.svgNo alt attribute provided
...2e428ac246d753b27_Paperplane_hero_01.svgNo alt attribute provided
...a0296484d8d459829feee0_LT_Devices_01.jpgNo alt attribute provided
...d7/618247f2e428ac0d69753b29_97137E0E.pngNo alt attribute provided
...3b23_MT_PaymentPage-tablet_211004-01.jpgNo alt attribute provided
...3fc753b26_MT_Terminal-A50demo_211004.jpgNo alt attribute provided
...8247f2e428ac3028753d0e_img_MT_market.jpgMärkte, Messen & Events
...47f2e428ac4944753d0d_img_MT_delivery.jpgKuriere, Lieferdienste & Fahrservices
.../618247f2e428ac5663753d0c_img_MT_bar.jpgBars & Restaurants
...f2e428ac3e2a753d0b_img_MT_hotellerie.jpgHotels
...618247f2e428acdb1d753d0a_img_MT_club.jpgBars, Clubs & Stores
...28ac7697753bbc_img_MT_shoppingcenter.jpgEinzelhandel (Retail)
...618247f2e428ac3868753ba8_img_MT_cafe.jpgGastronomie & Hotellerie
...2e428ace6dd753b8f_slider_omnichannel.jpgNo alt attribute provided
.../618247f2e428ac2471753b8e_slider_ufo.jpgNo alt attribute provided
...47f2e428ac3dd1753b8d_slider_automats.jpgNo alt attribute provided
...428ace441753b90_slider_customization.jpgNo alt attribute provided
...47f2e428ac0e83753b91_sldier_checkout.jpgNo alt attribute provided
...f2e428aceff4753b2a_slider-arrow-left.svgNo alt attribute provided
...2e428ac0354753b2b_slider-arrow-right.svgNo alt attribute provided
...2e428ac77e6753bc9_Plugins_Overlay_02.pngNo alt attribute provided
...c0109d7aaa12823_logo_alternative_JTL.svgJTL
...1e1c5f30d12_logo_alternative_shopify.svgShopify
...5b7bf0c7_logo_alternative_salesforce.svgSalesforce B2C Commerce
...2753d39_logo_alternative_woocommerce.svgWooCommerce
...c4fbc753d67_logo_alternative_magento.svgMagento 2
...37753d63_logo_alternative_lightspeed.svgLightspeed (eCom)
...0a9e5ed01e_logo_alternative_treibauf.svgMatchbox
...0a9e5ed01e_logo_alternative_treibauf.svgPepper
...99a0753d7c_logo_alternative_shopware.svgShopware 6
...99a0753d7c_logo_alternative_shopware.svgShopware
...8ac940e753d59_logo_alternative_ecwid.svgEcwid
...c4fbc753d67_logo_alternative_magento.svgMagento 1
...28acb726753d70_logo_alternative_oxid.svgOxid
...ac523d753d57_logo_alternative_drupal.svgDrupal
...8ac2e71753d61_logo_alternative_jimdo.svgJimdo
...28ac363d753d6a_logo_alternative_odoo.svgOdoo
...a5ac0f4cc8_logo_alternative_craftcms.svgCraft Commerce
...b81b753d6d_logo_alternative_opencart.svgOpenCart
...bb753d73_logo_alternative_peppershop.svgPepperShop POS
...bb753d73_logo_alternative_peppershop.svgPepperShop Onlineshop
...53d79_logo_alternative_plentymarkets.svgplentymarkets
...d257329e_logo_alternative_prestashop.svgPrestaShop
...c460f6bad535_logo_alternative_gambio.svgGambio
...4c3b5ece80_logo_alternative_rentapos.svgRent-a-POS
...230a1b_logo_alternative_shopondemand.svgShopOnDemand.ch
...6a3ab264f3f19_logo_alternative_flour.svgflour
...c17f5147dff4_logo_alternative_protel.svgProtel
...753d52_logo_alternative_digitalhusky.svgDigital Husky
...ac1511753d76_logo_alternative_pingen.svgPingen
...aab753d5e_logo_alternative_hellotess.svgHelloTESS
...f2e428ac3643753d40_logo_alternative_.svgDebt Collection
...b753d87_logo_alternative_postfinance.svgPostFinance FDS
...f2e428ac3643753d40_logo_alternative_.svgSMTP
...c4988753d5c_logo_alternative_etermin.svgeTermin
...af753d82_logo_alternative_smartstore.svgSmartstore
.../Basic/assets/placeholder.60f9b1840c.svgNo alt attribute provided
...f2e428aceff4753b2a_slider-arrow-left.svgNo alt attribute provided
...2e428ac0354753b2b_slider-arrow-right.svgNo alt attribute provided
...753ad7/618247f2e428ac27ac753b3b_logo.svgNo alt attribute provided
...47f2e428acb1da753b37_Fiege_Logo_2019.svgNo alt attribute provided
...3ad7/618247f2e428ace35f753b39_layer1.svgNo alt attribute provided
...f2e428ac364e753b38_Fossil_Group_logo.svgNo alt attribute provided
...2e428ac9347753b3a_Swiss_Re_2013_logo.svgNo alt attribute provided
...152_Newsslider_wallee-BASO_240502-01.jpgNo alt attribute provided
..._Previewimage_Juice_PR_02_Newsslider.jpgNo alt attribute provided
...7399aea8597a021f886_Titleimage_MC_01.jpgNo alt attribute provided
...dbc2ff4a2e073450482_Hero_EV_04c-2024.jpgNo alt attribute provided
...7af81c4ed0886fedb_Previewimage_QR_01.jpgNo alt attribute provided
...428ac7c25753b43_Logo_wallee_white_01.svgNo alt attribute provided

Page structure

H1 heading
(Critically important)
#homeofpayments
The H1 heading consists of only one word. There should be more information given.
The H1 heading is too short (15 characters). It should be at least 20 Characters long.
Headings
(Important)
There are 72 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 #homeofpayments
H2 Mit wallee Zahlungen anbieten
H2 Zahlungen im Internet
H2 E-Commerce
H2 Zahlungen im Geschäft
H2 Terminals
H2 Weitere Möglichkeiten
H2 Einfacher, als Sie denken. So individuell, wie Sie möchten.
H2 wallee - easy pay any way
H2 News & Aktionen
H2 Was gibt's Neues
H3 JTL
H3 Shopify
H3 Salesforce B2C Commerce
H3 WooCommerce
H3 Magento 2
H3 Lightspeed (eCom)
H3 Matchbox
H3 Pepper
H3 Shopware 6
H3 Shopware
H3 Ecwid
H3 Magento 1
H3 Oxid
H3 Drupal
H3 Jimdo
H3 Odoo
H3 Craft Commerce
H3 OpenCart
H3 PepperShop POS
H3 PepperShop Onlineshop
H3 plentymarkets
H3 PrestaShop
H3 Gambio
H3 Rent-a-POS
H3 ShopOnDemand.ch
H3 flour
H3 Protel
H3 Digital Husky
H3 Pingen
H3 HelloTESS
H3 Debt Collection
H3 PostFinance FDS
H3 SMTP
H3 eTermin
H3 Smartstore
H3 Magento
H3 Ein Partner für alle Kanäle
H3 Top Technologie
H3 Volle Flexibilität
H3 Baldegger+Sortec setzt exklusiv auf wallee
H3 Juice und wallee geben Partnerschaft bekannt
H3 Click to Pay mit Mastercard
H3 Kartenzahlung für Ladeinfrastruktur
H3 Einfach & flexibel: wallee QR Payments
H3 Testen Sie das wallee Portal kostenfrei
H4 Märkte, Messen & Events
H4 Kuriere, Lieferdienste & Fahrservices
H4 Bars & Restaurants
H4 Hotels
H4 Bars, Clubs & Stores
H4 Einzelhandel (Retail)
H4 Gastronomie & Hotellerie
H4 Omnichannel
H4 Automatisierte Buchhaltung
H4 Zahlungen an Automaten
H4 Customization
H4 Check-Out
H4 Zahlungen managen
H4 Für Entwickler
H4 Über wallee
H4 Support
Some internal link anchor texts are too long.
Some anchor texts are used more than once.
The number of internal links is ok.
All internal links are not using dynamic parameters.
There are too many external links (43) on this page.

Found links on this page

LinkAttributesAnchor text
https://wallee.com/No Text
/zahlungen-annehmen/zahlungsme...Moderne Zahlungsmethoden im Internet anbieten ECOMMeRCE
/zahlungen-annehmen/kartenzahl...Kartenzahlung im Geschäft, POS oder mobil anbieten Terminals
/zahlungen-annehmen/zahlungen-...Zahlung an Automaten anbieten Unattended
/zahlungen-annehmen/omnichannelOmnichannel
/zahlungen-annehmen/wiederkehr...Wiederkehrende Zahlungen
/zahlungen-annehmen/automatisi...Automatisierte Buchhaltung
/zahlungen-annehmen/zahlungslinksZahlungslinks & QR Payments
/zahlungen-annehmen/alle-zahlu...Alle Zahlungsmethoden
https://app-wallee.com/de/user...External Zum wallee Portal
https://terminal-shop.wallee.c...External Subdomain Zum Terminal Shop
/partner/partnerprogrammFür AgenturenAffiliate Partner
/partner/partnerprogrammFür AnbieterBUSINESS Partner
/partner/partnerprogrammFür Entwickler DEVELOPER PROGRAMME
/partner/use-cases-storiesUse Cases & Stories
/ueber-wallee/kontaktAls Partner registrieren
/ueber-wallee/kontaktDirekter Kontakt
/entwickler/pluginsPlugins
/entwickler/checkoutCheck-Out
https://wallee.com/entwickler/sdkSDKs
/entwickler/customizationCustomization
https://wallee.com/entwickler/apiAPI
/entwickler/webhooksWebhooks
https://app-wallee.com/de/docNew window External book Dokumentation
https://github.com/wallee-paymentNew window External Github Repositories
/ueber-wallee/blogBlog
/ueber-wallee/kontaktKontakt
/ueber-wallee/downloadsDownloads
/ueber-wallee/supportSupport
/ueber-wallee/karriereKarriere
https://www.linkedin.com/compa...New window External Subdomain No Text
https://www.facebook.com/walle...New window External Subdomain No Text
https://github.com/wallee-paymentNew window External No Text
https://www.instagram.com/wall...New window External Subdomain No Text
https://www.youtube.com/user/c...New window External Subdomain No Text
https://wallee.com/cultureCompany Culture
https://app-wallee.com/pricingNew window External Preisoptionen
https://app-wallee.com/user/si...External Kostenlos registrieren
https://app-wallee.com/user/loginExternal account_circleLogin
https://app-wallee.com/user/loginExternal settingsAccount
/zahlungen-annehmen/terminal-shopshopping_cartTerminal Shop
/ueber-wallee/kontaktSubdomain support_agentVertrieb kontaktieren
/zahlungen-annehmen/zahlungsme...Text duplicate Moderne Zahlungsmethoden im Internet anbieten ECOMMeRCE
/zahlungen-annehmen/kartenzahl...Text duplicate Kartenzahlung im Geschäft, POS oder mobil anbieten Terminals
/zahlungen-annehmen/zahlungen-...Text duplicate Zahlung an Automaten anbieten Unattended
/zahlungen-annehmen/omnichannelText duplicate Omnichannel
/zahlungen-annehmen/wiederkehr...Text duplicate Wiederkehrende Zahlungen
/zahlungen-annehmen/automatisi...Text duplicate Automatisierte Buchhaltung
/zahlungen-annehmen/zahlungslinksText duplicate Zahlungslinks & QR Payments
/zahlungen-annehmen/alle-zahlu...Text duplicate Alle Zahlungsmethoden
https://app-wallee.com/de/user...External Text duplicate Zum wallee Portal
https://terminal-shop.wallee.c...External Subdomain Text duplicate Zum Terminal Shop
/partner/partnerprogrammText duplicate Für AgenturenAffiliate Partner
/partner/partnerprogrammText duplicate Für AnbieterBUSINESS Partner
/partner/partnerprogrammText duplicate Für Entwickler DEVELOPER PROGRAMME
/partner/use-cases-storiesText duplicate Use Cases & Stories
/ueber-wallee/kontaktText duplicate Als Partner registrieren
/ueber-wallee/kontaktText duplicate Direkter Kontakt
/entwickler/pluginsText duplicate Plugins
/entwickler/checkoutText duplicate Check-Out
https://wallee.com/entwickler/sdkText duplicate SDKs
/entwickler/customizationText duplicate Customization
https://wallee.com/entwickler/apiText duplicate API
/entwickler/webhooksText duplicate Webhooks
https://app-wallee.com/de/docNew window External Text duplicate book Dokumentation
https://github.com/wallee-paymentNew window External Text duplicate Github Repositories
/ueber-wallee/blogText duplicate Blog
/ueber-wallee/kontaktText duplicate Kontakt
/ueber-wallee/downloadsText duplicate Downloads
/ueber-wallee/supportText duplicate Support
/ueber-wallee/karriereText duplicate Karriere
https://www.linkedin.com/compa...New window External Subdomain No Text
https://www.facebook.com/walle...New window External Subdomain No Text
https://github.com/wallee-paymentNew window External No Text
https://www.instagram.com/wall...New window External Subdomain No Text
https://www.youtube.com/user/c...New window External Subdomain No Text
https://wallee.com/cultureText duplicate Company Culture
https://app-wallee.com/pricingNew window External Text duplicate Preisoptionen
https://app-wallee.com/de/user...External Text duplicate Kostenlos registrieren
https://wallee.com/Anchor Mehr entdecken
/zahlungen-annehmen/zahlungsme...Moderne Zahlungsmethoden im Internet anbieten ECOMMERCE
/zahlungen-annehmen/kartenzahl...Kartenzahlungen im Geschäft, am POS oder mobil anbieten TERMINALS
/zahlungen-annehmen/zahlungen-...Zahlungen an Automaten anbieten UNATTENDED
https://app-wallee.com/de/user...External Text duplicate Kostenlos registrieren
https://wallee.com/Anchor Weitere Möglichkeiten
/zahlungen-annehmen/alle-zahlu...moderne Zahlungsmethoden
/entwickler/checkoutText duplicate Check-Out
/entwickler/pluginsText duplicate Plugins
/zahlungen-annehmen/zahlungsme...Mehr erfahren
https://app-wallee.com/user/loginExternal wallee Portal
/zahlungen-annehmen/kartenzahl...Alle Terminals ansehen
https://terminal-shop.wallee.com/New window External Subdomain Text duplicate Zum Terminal Shop
/zahlungen-annehmen/omnichannelOmnichannel Mit wallee haben Sie einen Partner für alle Kanäle, der Sie bei Ihrem Wachstum und Omnichannel Strategie unterstützt. Jetzt mehr zu Omnichannel e...
/zahlungen-annehmen/automatisi...Automatisierte Buchhaltung Von der Rechnungsstellung über den Abgleich verschiedener Zahlungsarten bis zur Erstellung von Berichten für Ihre Buchhaltung. Jet...
/zahlungen-annehmen/zahlungen-...Zahlungen an Automaten Mit wallee können Sie natürlich auch Zahlungen über Ihre Automaten abwickeln. Entdecken Sie jetzt alle Funktionen und Vorteile im Bere...
/entwickler/pluginsText duplicate Plugins
https://wallee.com/entwickler/apiText duplicate API
https://wallee.com/entwickler/sdkText duplicate SDKs
https://app-wallee.com/de/docNew window External Dokumentation
https://app-wallee.com/en-us/d...New window External Zur API Referenz
https://wallee.com/entwickler/sdkText duplicate SDKs
/entwickler/pluginsText duplicate Plugins
https://wallee.com/plugins/jtlJTL Plugin Integrieren Sie wallee Payments in Ihrer JTL-Software. Umfangreiche Zahlungsfunktionen.
IMG-ALT JTL
/plugins/shopifyShopify Plugin Nutzen Sie wallee in Ihrem Shopify Onlineshop.
IMG-ALT Shopify
/plugins/salesforceSalesforce B2C Commerce Plugin Integrierter Check-Out.
IMG-ALT Salesforce B2C Commerce
/plugins/woocommerceWooCommerce Plugin Plugin für WooCommerce, dem Shopsystem für Wordpress.
IMG-ALT WooCommerce
/plugins/magento-2Magento 2 Plugin Anbindung von wallee in Ihrem Magento 2 Shop.
IMG-ALT Magento 2
/plugins/lightspeedLightspeed (eCom) Plugin Anbindung an das cloudbasierte E-Commerce System.
IMG-ALT Lightspeed (eCom)
/plugins/treibauf-matchboxMatchbox Integration Moderne Reconciliation & Payment Analytics Software.
IMG-ALT Matchbox
/plugins/treibauf-pepperPepper Integration Die universelle Verbindung zwischen POS-Terminal und Kasse.
IMG-ALT Pepper
/plugins/shopware-6Shopware 6 Plugin Nutzen Sie wallee in Ihrem Shopware Onlineshop.
IMG-ALT Shopware 6
/plugins/shopwareShopware Plugin Nutzen Sie wallee in Ihrem Shopware Onlineshop.
IMG-ALT Shopware
https://wallee.com/plugins/ecwidEcwid Plugin Anbindung an die beliebte E-Commerce Lösung Ecwid.
IMG-ALT Ecwid
/plugins/magento-1Magento 1 Plugin Anbindung von wallee in Ihrem Magento 1 Shop.
IMG-ALT Magento 1
https://wallee.com/plugins/oxidOxid Plugin Das Plugin bindet wallee in Ihrem Oxid Shop ein.
IMG-ALT Oxid
https://wallee.com/plugins/drupalDrupal Plugin Anbindung an die E-Commerce Lösung von Drupal.
IMG-ALT Drupal
https://wallee.com/plugins/jimdoJimdo Plugin Plugin für das beliebte Website-Baukastensystem Jimdo.
IMG-ALT Jimdo
https://wallee.com/plugins/odooOdoo Plugin Plugin für Ihren Odoo Shop. Nutzen Sie wallee in Odoo.
IMG-ALT Odoo
/plugins/craft-commerceCraft Commerce Plugin Plugin für die Einbindung von wallee in Craft Commerce (Craft CMS)
IMG-ALT Craft Commerce
/plugins/opencartOpenCart Plugin Anbindung an das Open Source Shopsystem OpenCart.
IMG-ALT OpenCart
/plugins/peppershop-posPepperShop POS Plugin Nutzen Sie wallee mit dem mordernen Kassesystem.
IMG-ALT PepperShop POS
/plugins/peppershop-onlineshopPepperShop Onlineshop Plugin Nutzen Sie wallee in Ihrem PepperShop Onlineshop
IMG-ALT PepperShop Onlineshop
/plugins/plentymarketsplentymarkets Plugin Anbindung an das E-Commerce ERP-System plentymarkets.
IMG-ALT plentymarkets
/plugins/prestashopPrestaShop Plugin Anbindung an das Open-Source E-Commerce System.
IMG-ALT PrestaShop
https://wallee.com/plugins/gambioGambio Plugin Nutzen Sie wallee in Ihrem Gambio Onlineshop.
IMG-ALT Gambio
/plugins/rent-a-posRent-a-POS Integration Ihr Kassensystem auf jedem beliebigen PC, Laptop oder Tablet.
IMG-ALT Rent-a-POS
/plugins/shopondemandShopOnDemand.ch Integration Nutzen Sie wallee mit ShopOnDemand.ch
IMG-ALT ShopOnDemand.ch
https://wallee.com/plugins/flourflour Integration Verbinden Sie wallee mit den flour Kassenkomponenten.
IMG-ALT flour
https://wallee.com/plugins/protelProtel Integration Zahlungsabwicklung in der Hotel Management Software Protel.
IMG-ALT Protel
/plugins/digital-huskyDigital Husky Plugin Onlineshop Tool, das auf Open Source Frameworks aufbaut.
IMG-ALT Digital Husky
https://wallee.com/plugins/pingenPingen Plugin Praktischer Post-Versand von Rechnungen über die Cloud.
IMG-ALT Pingen
/plugins/hellotessHelloTESS Plugin Anbindung an die helloTESS iPad Kassen für die Gastronomie.
IMG-ALT HelloTESS
/plugins/debt-collectionDebt Collection Plugin Automatisierte Erstellung von Rechnungen & Mahnungen.
IMG-ALT Debt Collection
/plugins/postfinance-fdsPostFinance FDS Plugin Verknüpfen Sie Ihr PostKonto über das File Delivery System.
IMG-ALT PostFinance FDS
https://wallee.com/plugins/smtpSMTP Plugin Senden Sie Rechnugnsdokumente per Mail an Ihre Kunden.
IMG-ALT SMTP
/plugins/etermineTermin Plugin Einfache Anbindung an die Online-Terminplanungssoftware.
IMG-ALT eTermin
/plugins/smartstoreSmartstore Plugin Anbindung and das grosse E-Commerce System Smartstore.
IMG-ALT Smartstore
/entwickler/pluginsnavigate_nextALLE PLUGINS ANSEHEN
/blog-posts/baldegger-sortec-s...Jetzt Artikel lesen
https://baldeggersortec.ch/zah...New window External Partnerseite
/blog-posts/juice-und-walleeZur Pressemeldung
/promo/ev-chargingNew window Subdomain Persönliche Beratung
/partner/mastercard-click-to-payMehr dazu
/promo/ev-chargingText duplicate Mehr erfahren
/promo/ev-chargingNew window Anchor Online-Beratung
/blog-posts/wallee-qr-paymentsText duplicate Mehr erfahren
https://app-wallee.com/user/si...New window External Kostenfrei registrieren
https://app-wallee.com/user/si...External Jetzt anmelden
/ueber-wallee/kontaktVertrieb kontaktieren
/zahlungen-annehmen/zahlungsme...E-Commerce
/zahlungen-annehmen/kartenzahl...Terminals
/zahlungen-annehmen/zahlungen-...Automaten
/zahlungen-annehmen/omnichannelText duplicate Omnichannel
https://app-wallee.com/docNew window External Text duplicate Dokumentation
https://wallee.com/entwickler/sdkSDK
https://wallee.com/entwickler/apiText duplicate API
/entwickler/pluginsText duplicate Plugins
/ueber-wallee/kontaktText duplicate Kontakt
/ueber-wallee/blogText duplicate Blog
/ueber-wallee/downloadsText duplicate Downloads
/ueber-wallee/karriereText duplicate Karriere
/ueber-wallee/supportSupport Übersicht
https://help.wallee.com/New window External Subdomain Supportformular
https://support.wallee.com/New window External Subdomain Help Center
https://status.wallee.com/New window External Subdomain System Status
/zahlungen-annehmen/zahlungslinksZahlungslinks versenden
/zahlungen-annehmen/wiederkehr...Text duplicate Wiederkehrende Zahlungen
/zahlungen-annehmen/automatisi...Text duplicate Automatisierte Buchhaltung
/zahlungen-annehmen/alle-zahlu...Zahlungsmethoden
/entwickler/checkoutText duplicate Check-Out
/entwickler/customizationText duplicate Customization
/entwickler/webhooksText duplicate Webhooks
https://www.linkedin.com/compa...New window External Subdomain LinkedIn
https://www.facebook.com/walle...New window External Subdomain Facebook
https://github.com/wallee-paymentNew window External Github
https://app-wallee.com/user/si...External Text duplicate Zum wallee Portal
/zahlungen-annehmen/terminal-u...Terminal Übersicht
/legal/impressumImpressum
/legal/datenschutzhinweiseDatenschutzhinweise
/legal/disclaimerDisclaimer
https://wallee.com/legal/agbAGB
https://wallee.com/legal/pciPCI DSS
http://change-language.weglot....External Subdomain Englisch
https://app-wallee.com/de/user...External account_circle Login
https://app-wallee.com/de/user...External settings Account verwalten
/legal/datenschutzhinweiseDatenschutzhinweisen

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://wallee.com/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
This page uses GZip for compressed data transmission.
Performance
(Somewhat important)
The page response time is very slow (1.97 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
The file size of the HTML document is fine (130 kB).

HTTP Response Header

NameValue
dateThu, 16 May 2024 13:26:33 GMT
content-typetext/html
content-length25959
x-lambda-idabdf9757-690a-4c4d-a18b-9d46a27467d8
content-encodinggzip
accept-rangesbytes
age0
x-served-bycache-dub4358-DUB
x-cacheMISS
x-cache-hits0
x-timerS1715865992.971770,VS0,VE1764
varyx-wf-forwarded-proto, Accept-Encoding
x-cluster-nameeu-west-1-prod-hosting-red
statuscode200
http_versionHTTP/2

External factors

Blacklists
(Nice to have)
This website is not classified "for adult only".
This website has excellent links from other websites.
This page has backlinks from 346 referring domains.
This page has 465,913 backlinks.
This page has backlinks from 240 different ip addresses.
Facebook popularity
(Somewhat important)
The page has 0 shares and comments on Facebook.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

No valid Robots.txt file was found.

Similar sites

Search preview

wallee.com
wallee | Moderne Zahlungsmethoden auf jedem Kanal
Easy pay any way. Ob moderne Zahlungsmethoden im Internet, Kartenzahlungen im Geschäft oder die Verarbeitung von Zahlungen an Automaten. Entdecken Sie die vielfältigen Möglichkeiten mit wallee.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
wallee84%Check
im wallee73%Check
Pay68%Check
wallee Portal65%Check
wallee Terminals63%Check
ber wallee63%Check
im Internet60%Check
im Geschäft60%Check
easy pay60%Check
wallee QR Payments60%Check
Show more keywords and terms

Test up to 1.000 webpages of wallee.com with our free plan!

Try For Free
No trial. It's just free!

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions