Tchibo-coffeeservice.de - SEO Check

Übersicht der SEO Analyse
Metaangaben
83% 
Seitenqualität
63% 
Seitenstruktur
100% 
Verlinkung
25% 
Server
54% 
Externe Faktoren
100% 
SEO Score
Antwortzeit
2,57 s
Dateigröße
384,80 kB
Wörter
3000
Medien
115
Anzahl Links
341 Intern / 15 Extern

To-do Liste mit SEO Optimierungen

Meta-Angaben im HTML

Titel
(Extrem wichtig)
Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
Die Länge des Titels ist optimal. (519 Pixel von maximal 580 Pixel Länge)
Es gibt keine Wortwiederholungen im Titel.
Meta-Description
(Extrem wichtig)
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
Die Meta-Description ist zu lang. (1035 Pixel von maximal 1000 Pixel) Jetzt optimieren
Crawlbarkeit
(Extrem wichtig)
Es gibt keine Probleme beim Zugriff auf die Webseite.
Canonical Link
(Wichtig)
https://www.tchibo-coffeeservice.de/
Die Seite hat einen korrekten Canonical Link.
Sprache
(Wenig wichtig)
Im Text erkannte Sprache: de
Im HTML angegebene Sprache: de-de
Serverstandort: Deutschland
Die Sprache wird im HTML Code wie folgt angegeben: de-de
Alternate/Hreflang Links
(Wenig wichtig)
Der Alternate Link auf die Seite selbst fehlt.
Weitere Metatags
(Wenig wichtig)
Es gibt keinen rel next Meta Tag auf der Seite.
Es gibt keinen rel prev Meta Tag auf der Seite.
Domain
(Wenig wichtig)
Die Domain ist keine Subdomain.
Die Länge der Domain ist gut.
Die Domain enthält keine Umlaute.
Seiten URL
(Wenig wichtig)
In der URL wurden keine Parameter entdeckt.
In der URL wurde keine Session ID entdeckt.
Die URL hat nicht zu viele Unterverzeichnisse.
Zeichensatzkodierung
(Wenig wichtig)
Die Angaben zur Zeichensatzkodierung (UTF-8) sind fehlerfrei.
Doctype
(Nice to have)
Die Doctype Angabe HTML 5 ist korrekt angegeben.
Die Doctype Angabe befindet sich an erster Stelle im HTML-Code.
Favicon
(Nice to have)
Das Favoriten Icon (Favicon) ist korrekt verlinkt.

Meta Tags

NameWert
viewportwidth=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
robotsindex, follow
generatorSilverStripe - http://silverstripe.org
descriptionFinden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
langde-de
Content-Typetext/html; charset=utf-8
Content-typetext/html; charset=utf-8
charsetutf-8

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von tchibo-coffeeservice.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Seitenqualität

Inhalt
(Extrem wichtig)
Wörter aus der H1 Überschrift werden nicht im Text der Seite verwendet.
Es befinden sich 2 Text-Duplikate auf der Seite:
  • Duplikat: Bis zu 8 Heißgetränke in zwei Größen Zubereitung mit Milchpulver M...
Der Inhalt ist mit 3000 Wörtern in Ordnung.
Der Text besteht zu 27.5% aus Füllwörtern.
Worte aus dem Titel werden im Text wiederholt.
Im Text befindet sich eine Aufzählung, dies deutet auf eine gute Textstruktur hin.
Es wurden 46 Fließtextblöcke auf der Seite gefunden.
Es wurden keine Platzhalter Texte bzw. Bilder gefunden.
Die durchschnittliche Satzlänge ist mit 13.52 Wörtern gut.
Frames
(Extrem wichtig)
Die Seite hat kein Frameset.
Mobile
(Wenig wichtig)
Es ist kein Apple-Touch Icon angegeben.
Die Webseite lädt 27 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Der angegebene Viewport (width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0) ist korrekt.
Bold- und Strongtags
(Wenig wichtig)
Die Nutzung von Strong- und Bold-Tags ist optimal. Wir empfehlen für diese Webseite die Verwendung von bis zu 60 Tags.
Bilder Optimierung
(Wenig wichtig)
Bei 21 Bildern fehlt das Alt-Attribut. Der Inhalt von Alt-Attributen wird von Suchmaschinen auch als Text gewertet und ist wichtig für die Bildersuche.
Soziale Vernetzung
(Nice to have)
Es befinden sich wenige Social-Sharing Möglichkeiten auf der Seite. Mit Plugins zum Teilen, kann die Reichweite der Seite in sozialen Netzwerken erhöht werden.
Zusätzliches Markup
(Nice to have)
Es wurde kein zusätzliches Markup gefunden.
HTTPS
(Wenig wichtig)
Die Seite verwendet HTTPS um Daten sicher zu übertragen.
Alle eingebundenen Dateien werden ebenfalls über HTTPS ausgeliefert.

Medienliste

URLALT-AttributeTitel
/services/out/images/tcs_logo.svgtcs logologo tcs
/services/out/images/logo-ewh.pngewh logoewh logo
/services/out/images/tcs_logo_small.svgKein ALT-Attribut angegeben
/services/out/images/logo-small.pngewh logoewh logo
...es/out/images/dummy_telephone_header.jpgKein ALT-Attribut angegeben
...rogram/out/img/account_points_header.pngPOINTS
/services/out/images/lens0.pngKein ALT-Attribut angegeben
/services/out/images/login_mobile.pngKein ALT-Attribut angegeben
.../out/images/motiv-newsletter-inhalte.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svg02 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slider 1680x853 DESKTOP
/services/out/images/spinner.svg10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
...s/tchibo/images/dummys/icons/icon_05.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_06.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_01.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_02.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_03.jpgKein ALT-Attribut angegeben
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgPiacetto Caffè Crema Tradizionale, 1.000gPiacetto Caffè Crema Tradizionale, 1.000g
/services/out/images/spinner.svgPfefferminzePfefferminze
...s/content-slider/kaffeevollautomaten.pngkaffeevollautomatenkaffeevollautomaten
...ent-slider/kaffeevollautomaten-hover.pngkaffeevollautomaten hoverkaffeevollautomaten hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
...ontent-slider/filterkaffeemaschinen2.pngfilterkaffeemaschinen2filterkaffeemaschinen2
...t-slider/filterkaffeemaschinen-hover.pngfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/kapselmaschinen.pngkapselmaschinenkapselmaschinen
...content-slider/kapselmaschinen-hover.pngkapselmaschinen hoverkapselmaschinen hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/siebtraeger.pngsiebtraegersiebtraeger
...ets/content-slider/siebtraeger-hover.pngsiebtraeger hoversiebtraeger hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svgkaffeevollautomatenkaffeevollautomaten
/services/out/images/spinner.svgkaffeevollautomaten hoverkaffeevollautomaten hover
/services/out/images/spinner.svgfilterkaffeemaschinen2filterkaffeemaschinen2
/services/out/images/spinner.svgfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/services/out/images/spinner.svgkapselmaschinenkapselmaschinen
/services/out/images/spinner.svgkapselmaschinen hoverkapselmaschinen hover
/services/out/images/spinner.svgsiebtraegersiebtraeger
/services/out/images/spinner.svgsiebtraeger hoversiebtraeger hover
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgWMF 1100 SWMF 1100 S
/services/out/images/spinner.svgCoffea IntenseCoffea Intense
/services/out/images/spinner.svgCoffea Professional PlusCoffea Professional Plus
/services/out/images/spinner.svgJura WE6 Piano Black (ohne Milchfunktion)Jura WE6 Piano Black (ohne Milchfunktion)
/services/out/images/spinner.svgJura WE8 Dark Inox (mit Milchfunktion)Jura WE8 Dark Inox (mit Milchfunktion)
/services/out/images/spinner.svgMoccamaster KBG Select alu gebürstetMoccamaster KBG Select alu gebürstet
/services/out/images/spinner.svgKombi-Paket "Moccamaster KBG Feine Milde"Kombi-Paket "Moccamaster KBG Feine Milde"
/services/out/images/spinner.svgMoccamaster KBG Select schwarzMoccamaster KBG Select schwarz
/services/out/images/spinner.svgMoccamaster KBG Select pastell grünMoccamaster KBG Select pastell grün
/services/out/images/spinner.svgMoccamaster KBG Select gelbMoccamaster KBG Select gelb
/services/out/images/spinner.svgMoccamaster KBG matt schwarzMoccamaster KBG matt schwarz
/services/out/images/spinner.svgEasy ProfessionalEasy Professional
/services/out/images/spinner.svgTWIN KapselautomatTWIN Kapselautomat
/services/out/images/spinner.svgBarista KapselautomatBarista Kapselautomat
/services/out/images/spinner.svgCafissimo Latte ProfessionalCafissimo Latte Professional
/services/out/images/spinner.svgStarterpaket "Siebträger"Starterpaket "Siebträger"
/services/out/images/spinner.svgExpobar Office Leva EB61, 2 BoilerExpobar Office Leva EB61, 2 Boiler
/services/out/images/spinner.svgWasserenthärter PatroneWasserenthärter Patrone
/services/out/images/spinner.svgCarimali KICCOCarimali KICCO
/services/out/images/spinner.svgWMF EspressoWMF Espresso
/assets/content-slider/ganze-bohne.pngganze bohneganze bohne
...ets/content-slider/ganze-bohne-hover.pngganze bohne hoverganze bohne hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/muehle.pngmuehlemuehle
/assets/content-slider/muehle-hover.pngmuehle hovermuehle hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/kapseln.pngkapselnkapseln
/assets/content-slider/kapseln-hover.pngkapseln hoverkapseln hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/tee-tasse.pngtee tassetee tasse
/assets/content-slider/tee-tasse-hover.pngtee tasse hovertee tasse hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svgganze bohneganze bohne
/services/out/images/spinner.svgganze bohne hoverganze bohne hover
/services/out/images/spinner.svgmuehlemuehle
/services/out/images/spinner.svgmuehle hovermuehle hover
/services/out/images/spinner.svgkapselnkapseln
/services/out/images/spinner.svgkapseln hoverkapseln hover
/services/out/images/spinner.svgtee tassetee tasse
/services/out/images/spinner.svgtee tasse hovertee tasse hover
/services/out/images/spinner.svgProbierpaket Café Crème KLEINProbierpaket Café Crème KLEIN
/services/out/images/spinner.svgProbierpaket Café Crème GROSSProbierpaket Café Crème GROSS
/services/out/images/spinner.svgTchibo Café Crème Classique, 500gTchibo Café Crème Classique, 500g
/services/out/images/spinner.svgTchibo Café Crème Suisse, 500gTchibo Café Crème Suisse, 500g
/services/out/images/spinner.svgTchibo Espresso Speciale, 500gTchibo Espresso Speciale, 500g
/services/out/images/spinner.svgTchibo Espresso Classico, 500gTchibo Espresso Classico, 500g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 6x80gTchibo Café Gourmet mild, 6x80g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 500gTchibo Café Gourmet mild, 500g
/services/out/images/spinner.svgTchibo Café Gourmet Elegant, 6x90gTchibo Café Gourmet Elegant, 6x90g
/services/out/images/spinner.svgTchibo Café Gourmet elegant, 500gTchibo Café Gourmet elegant, 500g
/services/out/images/spinner.svgTchibo Café Classic mild, 6x70gTchibo Café Classic mild, 6x70g
/services/out/images/spinner.svgServicepaket Business Line "Tchibo"Servicepaket Business Line "Tchibo"
/services/out/images/spinner.svgPiacetto Caffè Crema Supremo, KapselnPiacetto Caffè Crema Supremo, Kapseln
/services/out/images/spinner.svgPiacetto Espresso Supremo, KapselnPiacetto Espresso Supremo, Kapseln
/services/out/images/spinner.svgKaffee kräftig, 10 KapselnKaffee kräftig, 10 Kapseln
/services/out/images/spinner.svgKaffee mild, 10 KapselnKaffee mild, 10 Kapseln
/services/out/images/spinner.svgCaffè Crema mild, 10 KapselnCaffè Crema mild, 10 Kapseln
/services/out/images/spinner.svgEspresso elegant, 10 KapselnEspresso elegant, 10 Kapseln
/services/out/images/spinner.svgPure Iced Tea Grüner Tee Zitrone IngwerPure Iced Tea Grüner Tee Zitrone Ingwer
/services/out/images/spinner.svgPure Iced Tea Früchtetee Himbeer HolunderblütePure Iced Tea Früchtetee Himbeer Holunderblüte
/services/out/images/spinner.svgPure Tea Selection - Klassik BioPure Tea Selection - Klassik Bio
/services/out/images/spinner.svgPure Tea Selection - Earl GreyPure Tea Selection - Earl Grey
/services/out/images/spinner.svgPure Tea Selection - DarjeelingPure Tea Selection - Darjeeling
/services/out/images/spinner.svgPure Tea Selection - WaldbeerePure Tea Selection - Waldbeere
/assets/icons/icon-check-000000.pngicon check 000000
/assets/icons/icon-sprechblase-000000.pngicon sprechblase 000000
...ets/icons/icon-taschenrechner-000000.pngicon taschenrechner 000000
/assets/icons/icon-teetasse.pngicon teetasse
/assets/icons/icon-lampe.pngicon lampe
/assets/icons/icon-person.pngicon person
/assets/icons/icon-baum.pngicon baum
/services/out/images/spinner.svgKein ALT-Attribut angegeben
/services/out/images/spinner.svgKein ALT-Attribut angegeben
...es/out/images/dummy_telephone_header.jpgKein ALT-Attribut angegeben

Seitenstruktur

H1 Überschrift
(Extrem wichtig)
Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
Die H1-Überschrift ist perfekt.
Überschriften
(Wichtig)
Die Überschriftenstruktur ist fehlerfrei.

Überschriftenstruktur

Überschriften HierarchieInhalt
H1 Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
H2 Systemlösungen für Ihren Kaffee-Ausschank
H2 Rundum-Versorgung für höchsten Genuss
H2 Tchibo Coffee Service – das Unternehmen
Baselink: https://www.tchibo-coffeeservice.de/
Einige der Linktexte der internen Links sind zu lang.
Die internen Links haben teilweise dynamische Parameter. Alle internen URLs, welche nicht als nofollow markiert sind, sollten keine dynamischen Parameter aufweisen.
Einige der Linktexte wiederholen sich.
1 Links haben keinen Linktext oder nur Inhalt in Alt- und Titelattributen.
Die Anzahl an internen Links ist ok.
Es befinden sich 15 externe Links auf der Seite.
LinkAttributeLinktext
/IMG-ALT tcs logo
https://www.espressowarehouse.de/Extern IMG-ALT ewh logo
/Kein Text
https://www.espressowarehouse.de/Extern Textduplikat IMG-ALT ewh logo
/kundendienst-und-support/Kundenservice
/ihre-vorteile/Ihre Vorteile
/praemien/IMG-ALT POINTS
/DE
/Germany
https://www.tchibo-coffeeservi...Extern Austria
https://www.tchibo-coffeeservi...Extern Poland
https://www.tchibo-coffeeservi...Extern Czech Republic
http://www.tchibo-coffee.co.uk/Extern United Kingdom
https://www.tchibo-coffeeservi...Extern Worldwide
/Brutto
/shop/index.php?cl=oxubase&fnc...Netto
/Textduplikat Brutto
/shop/warenkorb/Kein Text
/shop/mein-konto/Login
/shop/kaffee/Kaffee
/shop/ganze-bohne/Ganze Bohne
/shop/mahlkaffee/Mahlkaffee
/shop/kapseln/Kapseln
/shop/instant/Instant
/shop/to-go-zubehoer/To Go Zubehör
/shop/kaffee-im-abo/Kaffee im Abo
/feine-milde/Feine Milde fürs Büro
/shop/milch-zucker/Milch, Zucker & Gebäck
/shop/fair-trade/Fair Trade
/kaffee-akademie/Kaffee-Akademie
/tchibo-kaffee/Tchibo
/shop/eduscho/Eduscho
/shop/piacetto-espresso/Piacetto
/davidoff-cafe/Davidoff
/shop/kaffeemaschinen/Kaffeemaschinen
/shop/kaffeevollautomaten/Kaffeevollautomaten
/shop/filterkaffeemaschinen/Filterkaffeemaschinen
/shop/kapselmaschinen/Kapselmaschinen
/shop/siebtraeger/Siebträger
/shop/maschinenfinder/Kaffeelösung planen
/shop/reinigung/Reinigung
/kaffeevollautomaten-mieten-fi...Mieten / Finanzieren
/filterkaffeemaschine-gratisFilterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebraucht-Angebote
/shop/kaffeemaschinenzubehoer/Kaffeemaschinenzubehör
/wasserspenderWasserspender
/shop/wmf-kaffeemaschinen/WMF
/shop/index.php?cl=alist&searc...Franke
/shop/moccamaster-kaffeemaschi...Moccamaster
/shop/jura-kaffeemaschinen/JURA
/shop/tee-mehr/Tee & mehr
/shop/tee/Tee
/shop/trinkschokolade/Trinkschokolade
/shop/milch-zucker/Textduplikat Milch, Zucker & Gebäck
/shop/geschirr-besteck/Geschirr & Besteck
/shop/to-go-zubehoer/Textduplikat To Go Zubehör
/shop/milchpulver-topping/Milchpulver & Topping
/shop/sirup-smoothies/Sirup
/wasserspender/Textduplikat Wasserspender
/pure-tea-selection/Pure Tea Selection
/shop/pure-fine-selection/Pure Fine Selection
/shop/davinci/DaVinci
/shop/spar-angebote/% Sale
/shop/angebote/?attrfilter[C21...Textduplikat Kaffeemaschinen
/shop/angebote/?attrfilter[C21...Textduplikat Kaffee
/shop/angebote/?attrfilter[C21...Textduplikat Tee & mehr
/shop/angebote/?attrfilter[C21...Restposten
/filterkaffeemaschine-gratisTextduplikat Filterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebrauchtmaschinen-Angebote
/1-19-mitarbeiter/Büros 1-19 Mitarbeiter
/ueber-20-mitarbeiter/Büros 20 + Mitarbeiter
/hotel/Hotels
/gastronomie/Gastronomie
/baeckerei/Bäckereien
/shop/maschinenfinder/Textduplikat Kaffeelösung planen
/kaffeevollautomaten-mieten-fi...Vollautomat mieten / finanzieren
/filterkaffeemaschine-gratisTextduplikat Filterkaffeemaschine GRATIS
/feine-milde/Textduplikat Feine Milde fürs Büro
/kaffee-akademie/Textduplikat Kaffee-Akademie
/inneneinrichtung/Einrichtungskonzepte
/wasserspenderTextduplikat Wasserspender
https://www.tchibo2go.de/Neues Fenster Extern Tchibo2Go-Komplettkonzept
/shop/kaffee-im-homeoffice/Fürs Homeoffice
/praemien/Textduplikat POINTS
/kontakt/Kontakt
/infos-anfordern/Infos anfragen
/kontakt/Textduplikat Kontakt
/shop/newsletter/Newsletter
/shop/bestellhistorie/1 Click Order
/shop/newsletter/Jetzt abonnieren
/kaffeevollautomaten-mieten-fi...IMG-ALT 02 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slider 1680x853 DESKTOP
/kaffeevollautomaten-mieten-fi...Kaffeevollautomat ab € 38 pro Monat mieten oder finanzieren Technischer Service vor Ort Flexible Vertragslaufzeiten Bis zu 25% Dauerrabatt auf Kaffee Jetzt i...
/filterkaffeemaschine-gratis/IMG-ALT 10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
/filterkaffeemaschine-gratis/Filterkaffeemaschine Gratis Inkl. 2 Pumpkannen Inkl. Austausch-Service Kaffee und Zubehör ab 7 Cent / Tasse Zum Angebot
/1-19-mitarbeiter/1-19 Mitarbeiter
/ueber-20-mitarbeiter/20 + Mitarbeiter
/gastronomie/Textduplikat Gastronomie
/hotel/Hotel
/baeckerei/Bäckerei
/shop/kaffeevollautomaten/Alle Kaffeevollautomaten anzeigen »
A-TITLE Alle Artikel
/shop/coffea-compact-oxid.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Versand
/shop/versand-zahlungsarten/Lieferdetails
/shop/coffea-compact-oxid.htmlZum Produkt
/shop/coffea-compact-oxid.htmlIn den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeevollautomaten/Nofollow Alle Artikel
/shop/kaffee/Alle Kaffees anzeigen »
A-TITLE Alle Artikel
/shop/piacetto-caffe-crema-tra...Piacetto Caffè Crema Tradizionale, 1.000g
IMG-ALT Piacetto Caffè Crema Tradizionale, 1.000g
A-TITLE Piacetto Caffè Crema Tradizionale, 1.000g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/piacetto-caffe-crema-tra...Textduplikat Zum Produkt
/shop/piacetto-caffe-crema-tra...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Nofollow Textduplikat Alle Artikel
/shop/tee/Alle Tees anzeigen »
A-TITLE Alle Artikel
/shop/nach-lieferant/tchibo/pf...Pfefferminze
IMG-ALT Pfefferminze
A-TITLE Pfefferminze
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/nach-lieferant/tchibo/pf...Textduplikat Zum Produkt
/shop/nach-lieferant/tchibo/pf...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee/Nofollow Textduplikat Alle Artikel
/shop/coffea-compact-oxid.htmlTextduplikat Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/coffea-compact-oxid.htmlTextduplikat Zum Produkt
/shop/coffea-compact-oxid.htmlTextduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/wmf-1100-s.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT WMF 1100 S
IMG-ALT WMF 1100 S
A-TITLE WMF 1100 S
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/wmf-1100-s.htmlTextduplikat Zum Produkt
/shop/wmf-1100-s.htmlTextduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/coffea-intense.htmlKombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Intense
IMG-ALT Coffea Intense
A-TITLE Coffea Intense
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/coffea-intense.htmlTextduplikat Zum Produkt
/shop/coffea-intense.htmlTextduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/nach-lieferant/tchibo/co...Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Professional Plus
IMG-ALT Coffea Professional Plus
A-TITLE Coffea Professional Plus
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/nach-lieferant/tchibo/co...Textduplikat Zum Produkt
/shop/nach-lieferant/tchibo/co...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/jura-we6-piano-black-ohn...Jura WE6 Piano Black (ohne Milchfunktion)
IMG-ALT Jura WE6 Piano Black (ohne Milchfunktion)
A-TITLE Jura WE6 Piano Black (ohne Milchfunktion)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/jura-we6-piano-black-ohn...Textduplikat Zum Produkt
/shop/jura-we8-dark-inox-mit-m...Jura WE8 Dark Inox (mit Milchfunktion)
IMG-ALT Jura WE8 Dark Inox (mit Milchfunktion)
A-TITLE Jura WE8 Dark Inox (mit Milchfunktion)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/jura-we8-dark-inox-mit-m...Textduplikat Zum Produkt
/shop/moccamaster-kbg-select-a...Moccamaster KBG Select alu gebürstet
IMG-ALT Moccamaster KBG Select alu gebürstet
A-TITLE Moccamaster KBG Select alu gebürstet
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/moccamaster-kbg-select-a...Textduplikat Zum Produkt
/shop/kombi-paket-moccamaster-...Kombi-Paket Kombi-Paket "Moccamaster KBG Feine Milde"
IMG-ALT Kombi-Paket "Moccamaster KBG Feine Milde"
A-TITLE Kombi-Paket "Moccamaster KBG Feine Milde"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kombi-paket-moccamaster-...Textduplikat Zum Produkt
/shop/kombi-paket-moccamaster-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-s...Moccamaster KBG Select schwarz
IMG-ALT Moccamaster KBG Select schwarz
A-TITLE Moccamaster KBG Select schwarz
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/moccamaster-kbg-select-s...Textduplikat Zum Produkt
/shop/moccamaster-kbg-select-s...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-p...Moccamaster KBG Select pastell grün
IMG-ALT Moccamaster KBG Select pastell grün
A-TITLE Moccamaster KBG Select pastell grün
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/moccamaster-kbg-select-p...Textduplikat Zum Produkt
/shop/moccamaster-kbg-select-p...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-select-g...Moccamaster KBG Select gelb
IMG-ALT Moccamaster KBG Select gelb
A-TITLE Moccamaster KBG Select gelb
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/moccamaster-kbg-select-g...Textduplikat Zum Produkt
/shop/moccamaster-kbg-select-g...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/moccamaster-kbg-matt-sch...Moccamaster KBG matt schwarz
IMG-ALT Moccamaster KBG matt schwarz
A-TITLE Moccamaster KBG matt schwarz
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/moccamaster-kbg-matt-sch...Textduplikat Zum Produkt
/shop/moccamaster-kbg-matt-sch...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/easy-professional-oxid.html6 Probier-Kapseln gratis Easy Professional
IMG-ALT Easy Professional
A-TITLE Easy Professional
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/easy-professional-oxid.htmlTextduplikat Zum Produkt
/shop/twin-kapselautomat.html6 Probier-Kapseln gratis TWIN Kapselautomat
IMG-ALT TWIN Kapselautomat
A-TITLE TWIN Kapselautomat
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/twin-kapselautomat.htmlTextduplikat Zum Produkt
/shop/barista-kapselautomat.htmlProbierkapseln gratis Barista Kapselautomat
IMG-ALT Barista Kapselautomat
A-TITLE Barista Kapselautomat
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/barista-kapselautomat.htmlTextduplikat Zum Produkt
/shop/cafissimo-latte-professi...Cafissimo Latte Professional
IMG-ALT Cafissimo Latte Professional
A-TITLE Cafissimo Latte Professional
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/cafissimo-latte-professi...Textduplikat Zum Produkt
/shop/starterpaket-siebtraeger...Sie sparen 150 € Starterpaket "Siebträger"
IMG-ALT Starterpaket "Siebträger"
A-TITLE Starterpaket "Siebträger"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/starterpaket-siebtraeger...Textduplikat Zum Produkt
/shop/expobar-office-leva-eb61...Expobar Office Leva EB61, 2 Boiler
IMG-ALT Expobar Office Leva EB61, 2 Boiler
A-TITLE Expobar Office Leva EB61, 2 Boiler
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/expobar-office-leva-eb61...Textduplikat Zum Produkt
/shop/wasserenthaerter-patrone...Wasserenthärter Patrone
IMG-ALT Wasserenthärter Patrone
A-TITLE Wasserenthärter Patrone
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/wasserenthaerter-patrone...Textduplikat Zum Produkt
/shop/carimali-kicco.htmlCarimali KICCO
IMG-ALT Carimali KICCO
A-TITLE Carimali KICCO
/shop/carimali-kicco.htmlTextduplikat Zum Produkt
/maschinen-kontakt/?mk_article...Anfrage
A-TITLE Kontakt
/shop/wmf-espresso.htmlWMF Espresso
IMG-ALT WMF Espresso
A-TITLE WMF Espresso
/shop/wmf-espresso.htmlTextduplikat Zum Produkt
/maschinen-kontakt/?mk_article...Textduplikat Anfrage
A-TITLE Kontakt
/shop/probierpaket-cafe-creme-...Sie sparen 10% Probierpaket Café Crème KLEIN
IMG-ALT Probierpaket Café Crème KLEIN
A-TITLE Probierpaket Café Crème KLEIN
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/probierpaket-cafe-creme-...Textduplikat Zum Produkt
/shop/probierpaket-cafe-creme-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/probierpaket-cafe-creme-...Sie sparen 25% Probierpaket Café Crème GROSS
IMG-ALT Probierpaket Café Crème GROSS
A-TITLE Probierpaket Café Crème GROSS
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/probierpaket-cafe-creme-...Textduplikat Zum Produkt
/shop/probierpaket-cafe-creme-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-creme-classi...Tchibo Café Crème Classique, 500g
IMG-ALT Tchibo Café Crème Classique, 500g
A-TITLE Tchibo Café Crème Classique, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-creme-classi...Textduplikat Zum Produkt
/shop/tchibo-cafe-creme-classi...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-creme-suisse...Tchibo Café Crème Suisse, 500g
IMG-ALT Tchibo Café Crème Suisse, 500g
A-TITLE Tchibo Café Crème Suisse, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-creme-suisse...Textduplikat Zum Produkt
/shop/tchibo-cafe-creme-suisse...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-espresso-speciale...Tchibo Espresso Speciale, 500g
IMG-ALT Tchibo Espresso Speciale, 500g
A-TITLE Tchibo Espresso Speciale, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-espresso-speciale...Textduplikat Zum Produkt
/shop/tchibo-espresso-speciale...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-espresso-classico...Tchibo Espresso Classico, 500g
IMG-ALT Tchibo Espresso Classico, 500g
A-TITLE Tchibo Espresso Classico, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-espresso-classico...Textduplikat Zum Produkt
/shop/tchibo-espresso-classico...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-mild...Tchibo Café Gourmet mild, 6x80g
IMG-ALT Tchibo Café Gourmet mild, 6x80g
A-TITLE Tchibo Café Gourmet mild, 6x80g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-gourmet-mild...Textduplikat Zum Produkt
/shop/tchibo-cafe-gourmet-mild...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-mild...Tchibo Café Gourmet mild, 500g
IMG-ALT Tchibo Café Gourmet mild, 500g
A-TITLE Tchibo Café Gourmet mild, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-gourmet-mild...Textduplikat Zum Produkt
/shop/tchibo-cafe-gourmet-mild...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-eleg...Tchibo Café Gourmet Elegant, 6x90g
IMG-ALT Tchibo Café Gourmet Elegant, 6x90g
A-TITLE Tchibo Café Gourmet Elegant, 6x90g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-gourmet-eleg...Textduplikat Zum Produkt
/shop/tchibo-cafe-gourmet-eleg...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-gourmet-eleg...Tchibo Café Gourmet elegant, 500g
IMG-ALT Tchibo Café Gourmet elegant, 500g
A-TITLE Tchibo Café Gourmet elegant, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-gourmet-eleg...Textduplikat Zum Produkt
/shop/tchibo-cafe-gourmet-eleg...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tchibo-cafe-classic-mild...Tchibo Café Classic mild, 6x70g
IMG-ALT Tchibo Café Classic mild, 6x70g
A-TITLE Tchibo Café Classic mild, 6x70g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tchibo-cafe-classic-mild...Textduplikat Zum Produkt
/shop/tchibo-cafe-classic-mild...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/servicepaket-business-li...Sie sparen 42 € Servicepaket Business Line "Tchibo"
IMG-ALT Servicepaket Business Line "Tchibo"
A-TITLE Servicepaket Business Line "Tchibo"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/servicepaket-business-li...Textduplikat Zum Produkt
/shop/piacetto-caffe-crema-sup...Piacetto Caffè Crema Supremo, Kapseln
IMG-ALT Piacetto Caffè Crema Supremo, Kapseln
A-TITLE Piacetto Caffè Crema Supremo, Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/piacetto-caffe-crema-sup...Textduplikat Zum Produkt
/shop/piacetto-espresso-suprem...Piacetto Espresso Supremo, Kapseln
IMG-ALT Piacetto Espresso Supremo, Kapseln
A-TITLE Piacetto Espresso Supremo, Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/piacetto-espresso-suprem...Textduplikat Zum Produkt
/shop/piacetto-espresso-suprem...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee-kraeftig-10-kapse...Kaffee kräftig, 10 Kapseln
IMG-ALT Kaffee kräftig, 10 Kapseln
A-TITLE Kaffee kräftig, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee-kraeftig-10-kapse...Textduplikat Zum Produkt
/shop/kaffee-kraeftig-10-kapse...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee-mild-10-kapseln.htmlKaffee mild, 10 Kapseln
IMG-ALT Kaffee mild, 10 Kapseln
A-TITLE Kaffee mild, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee-mild-10-kapseln.htmlTextduplikat Zum Produkt
/shop/kaffee-mild-10-kapseln.h...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/caffe-crema-mild-10-kaps...Caffè Crema mild, 10 Kapseln
IMG-ALT Caffè Crema mild, 10 Kapseln
A-TITLE Caffè Crema mild, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/caffe-crema-mild-10-kaps...Textduplikat Zum Produkt
/shop/caffe-crema-mild-10-kaps...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/espresso-elegant-10-kaps...Espresso elegant, 10 Kapseln
IMG-ALT Espresso elegant, 10 Kapseln
A-TITLE Espresso elegant, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/espresso-elegant-10-kaps...Textduplikat Zum Produkt
/shop/espresso-elegant-10-kaps...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-iced-tea-gruener-te...Sie sparen 20 % Pure Iced Tea Grüner Tee Zitrone Ingwer
IMG-ALT Pure Iced Tea Grüner Tee Zitrone Ingwer
A-TITLE Pure Iced Tea Grüner Tee Zitrone Ingwer
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-iced-tea-gruener-te...Textduplikat Zum Produkt
/shop/pure-iced-tea-gruener-te...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-iced-tea-fruechtete...Sie sparen 20 % Pure Iced Tea Früchtetee Himbeer Holunderblüte
IMG-ALT Pure Iced Tea Früchtetee Himbeer Holunderblüte
A-TITLE Pure Iced Tea Früchtetee Himbeer Holunderblüte
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-iced-tea-fruechtete...Textduplikat Zum Produkt
/shop/pure-iced-tea-fruechtete...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-klass...Pure Tea Selection - Klassik Bio
IMG-ALT Pure Tea Selection - Klassik Bio
A-TITLE Pure Tea Selection - Klassik Bio
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-tea-selection-klass...Textduplikat Zum Produkt
/shop/pure-tea-selection-klass...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-earl-...Pure Tea Selection - Earl Grey
IMG-ALT Pure Tea Selection - Earl Grey
A-TITLE Pure Tea Selection - Earl Grey
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-tea-selection-earl-...Textduplikat Zum Produkt
/shop/pure-tea-selection-earl-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-darje...Pure Tea Selection - Darjeeling
IMG-ALT Pure Tea Selection - Darjeeling
A-TITLE Pure Tea Selection - Darjeeling
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-tea-selection-darje...Textduplikat Zum Produkt
/shop/pure-tea-selection-darje...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/pure-tea-selection-waldb...Pure Tea Selection - Waldbeere
IMG-ALT Pure Tea Selection - Waldbeere
A-TITLE Pure Tea Selection - Waldbeere
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-tea-selection-waldb...Textduplikat Zum Produkt
/shop/pure-tea-selection-waldb...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Kaffeespezialitäten
/shop/kaffeevollautomaten/Textduplikat Kaffeevollautomaten
/shop/filterkaffeemaschinen/Textduplikat Filterkaffeemaschinen
/shop/tee-mehr/Kaffee- und Teeprodukten
/kundendienst-und-supportServicekonzepte
/shop/maschinenfinder/optimal für Sie geeigneten Maschine
/ihre-vorteile/Textduplikat Ihre Vorteile
/kundendienst-und-support/Textduplikat Kundenservice
/kontakt/Textduplikat Kontakt
/infos-anfordern/Textduplikat Infos anfragen
/shop/agb/AGB
/shop/versand-zahlungsarten/Lieferung & Zahlung
/shop/widerrufsrecht/Widerrufsrecht
/shop/out/zoxidflat/media/Tchi...Widerrufsformular
/shop/datenschutz/Datenschutz
/shop/impressum/Impressum
/unternehmen/Unternehmen
http://karriere.tchibo-coffees...Extern Subdomain Karriere
/faqsFAQ
/Textduplikat DE
/Textduplikat Germany
https://www.tchibo-coffeeservi...Extern Textduplikat Austria
https://www.tchibo-coffeeservi...Extern Textduplikat Poland
https://www.tchibo-coffeeservi...Extern Textduplikat Czech Republic
http://www.tchibo-coffee.co.uk/Extern Textduplikat United Kingdom
https://www.tchibo-coffeeservi...Extern Textduplikat Worldwide
https://www.tchibo.de/Extern Tchibo.de

Serverkonfiguration

HTTP-Weiterleitungen
(Extrem wichtig)
Die Seite leitet weiter auf "https://www.tchibo-coffeeservice.de/"
HTTP-Header
(Wichtig)
Es wird kein X-Powered HTTP-Header mitgesendet.
Der Webserver nutzt GZip zur komprimierten Übertragung der Webseite (HTML).
Performance
(Wenig wichtig)
Die Antwortzeit der HTML-Seite ist mit 2,57 Sekunden extrem langsam. Ein angepeiltes Ziel sollten 0,4 Sekunden sein. Suchmaschinen-Crawler können sonst Inhalte nicht so schnell aufnehmen und auch Besucher erwarten eine schnelle Webseite.
Die Webseite lädt 14 CSS Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Webseite lädt 27 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Dateigröße des HTML-Dokuments ist mit 385 kB in Ordnung.

HTTP-Header

NameWert
servernginx
dateSat, 31 Oct 2020 23:26:30 GMT
content-typetext/html; charset=utf-8
content-length31954
varyAccept-Encoding
set-cookie54 Zeichen
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-cache, no-store, must-revalidate
pragmano-cache
x-dynamiccachemiss at Sun, 01 Nov 2020 00:26:28 +0100
last-modifiedWed, 22 Jul 2020 07:41:53 GMT
content-encodinggzip
x-sc-app10.3.120.11:80
x-sc-lb10.3.120.9
statuscode200
http_versionHTTP/2

Externe Faktoren

Blacklists
(Extrem wichtig)
Die Seite wird von Webwiki nicht als "nur für Erwachsene" eingestuft.
Die Seite ist nicht auf der Shallalist verzeichnet.
Die Seite ist exzellent von anderen Webseiten verlinkt.
Die Seite hat Backlinks von 354 verweisenden Domains.
Die Seite hat insgesamt 15.910 Backlinks.
Die Seite hat Backlinks von 312 verschiedenen IP Adressen.
Verbreitung bei Facebook
(Wenig wichtig)
Die Seite hat viele Shares, Kommentare und Likes auf Facebook.
Eintrag bei Webwiki
(Nice to have)
Die Seite ist bei Webwiki verzeichnet.

Links von Wikipedia

Es wurden keine Links von Wikipedia gefunden.

Robots.txt

# For all robots
User-agent: *
Disallow: *searchparam*
Disallow: *cnid*
Disallow: *listtype*
Disallow: *ldtype*
Disallow: *force_sid*
Disallow: *addcompare*
Noindex: *searchparam*
Noindex: *cnid*
Noindex: *listtype*
Noindex: *ldtype*
Noindex: *force_sid*
Noindex: *addcompare*
Sitemap: https://www.tchibo-coffeeservice.de/shop/sitemaps/sitemap-index.xml
Disallow: /tchibo-smartcoffee/tchibo-smartcoffee-formular/

Popularität bei Facebook

Shares / Likes / Kommentare
625

Es werden nur die Daten zu der angegebenen URL abgefragt und nicht zu einer eventuell vorhandenen und auf der Seite verlinkten Facebook Seite.

Suchvorschau

www.tchibo-coffeeservice.de
Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand

Wichtigste Suchbegriffe

Folgende Keywords wurden erkannt. Überprüfe die Optimierung dieser Keywords für Deine Seite.

KeywordErgebnisPrüfen
Kaffee83%Check
Service82%Check
Tchibo82%Check
Tchibo Coffee Service81%Check
Kaffee Maschinen75%Check
Kaffee und Tee65%Check
Kaffeemaschinen63%Check
Bio Kaffee62%Check
Tchibo Espresso61%Check
Tassen Kaffee60%Check

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von tchibo-coffeeservice.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich