Tchibo-coffeeservice.de - SEO Check

Übersicht der SEO Analyse
Metaangaben
96% 
Seitenqualität
63% 
Seitenstruktur
100% 
Verlinkung
25% 
Server
54% 
Externe Faktoren
100% 
SEO Score
Antwortzeit
3,03 s
Dateigröße
390,90 kB
Wörter
2850
Medien
115
Anzahl Links
346 Intern / 14 Extern

To-do Liste mit SEO Optimierungen

Meta-Angaben im HTML

Titel
(Extrem wichtig)
Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
Die Länge des Titels ist optimal. (462 Pixel von maximal 580 Pixel Länge)
Es gibt keine Wortwiederholungen im Titel.
Meta-Description
(Extrem wichtig)
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
Die Meta-Description ist zu lang. (1001 Pixel von maximal 1000 Pixel) Jetzt optimieren
Crawlbarkeit
(Extrem wichtig)
Es gibt keine Probleme beim Zugriff auf die Webseite.
Canonical Link
(Wichtig)
https://www.tchibo-coffeeservice.de/
Die Seite hat einen korrekten Canonical Link.
Sprache
(Wenig wichtig)
Im Text erkannte Sprache: de
Im HTML angegebene Sprache: de-de
Serverstandort: Deutschland
Die Sprache wird im HTML Code wie folgt angegeben: de-de
Alternate/Hreflang Links
(Wenig wichtig)
Der Alternate Link auf die Seite selbst fehlt.
Weitere Metatags
(Wenig wichtig)
Es gibt keinen rel next Meta Tag auf der Seite.
Es gibt keinen rel prev Meta Tag auf der Seite.
Domain
(Wenig wichtig)
Die Domain ist keine Subdomain.
Die Länge der Domain ist gut.
Die Domain enthält keine Umlaute.
Seiten URL
(Wenig wichtig)
In der URL wurden keine Parameter entdeckt.
In der URL wurde keine Session ID entdeckt.
Die URL hat nicht zu viele Unterverzeichnisse.
Zeichensatzkodierung
(Wenig wichtig)
Die Angaben zur Zeichensatzkodierung (UTF-8) sind fehlerfrei.
Doctype
(Nice to have)
Die Doctype Angabe HTML 5 ist korrekt angegeben.
Die Doctype Angabe befindet sich an erster Stelle im HTML-Code.
Favicon
(Nice to have)
Das Favoriten Icon (Favicon) ist korrekt verlinkt.

Meta Tags

NameWert
viewportwidth=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
robotsindex, follow
generatorSilverStripe - http://silverstripe.org
descriptionFinden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand
langde-de
Content-Typetext/html; charset=utf-8
Content-typetext/html; charset=utf-8
charsetutf-8

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von tchibo-coffeeservice.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich

Seitenqualität

Inhalt
(Extrem wichtig)
Wörter aus der H1 Überschrift werden nicht im Text der Seite verwendet.
Es befinden sich 2 Text-Duplikate auf der Seite:
  • Duplikat: Bis zu 8 Heißgetränke in zwei Größen Zubereitung mit Milchpulver M...
Der Inhalt ist mit 2850 Wörtern in Ordnung.
Der Text besteht zu 26.2% aus Füllwörtern.
Worte aus dem Titel werden im Text wiederholt.
Im Text befindet sich eine Aufzählung, dies deutet auf eine gute Textstruktur hin.
Es wurden 40 Fließtextblöcke auf der Seite gefunden.
Die durchschnittliche Satzlänge ist mit 13.63 Wörtern gut.
Frames
(Extrem wichtig)
Die Seite hat kein Frameset.
Mobile
(Wenig wichtig)
Es ist kein Apple-Touch Icon angegeben.
Die Webseite lädt 25 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Der angegebene Viewport (width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0) ist korrekt.
Bold- und Strongtags
(Wenig wichtig)
Die Nutzung von Strong- und Bold-Tags ist optimal. Wir empfehlen für diese Webseite die Verwendung von bis zu 57 Tags.
Bilder Optimierung
(Wenig wichtig)
Bei 21 Bildern fehlt das Alt-Attribut. Der Inhalt von Alt-Attributen wird von Suchmaschinen auch als Text gewertet und ist wichtig für die Bildersuche.
Soziale Vernetzung
(Nice to have)
Es befinden sich wenige Social-Sharing Möglichkeiten auf der Seite. Mit Plugins zum Teilen, kann die Reichweite der Seite in sozialen Netzwerken erhöht werden.
Zusätzliches Markup
(Nice to have)
Es wurde kein zusätzliches Markup gefunden.
HTTPS
(Wenig wichtig)
Die Seite verwendet HTTPS um Daten sicher zu übertragen.
Alle eingebundenen Dateien werden ebenfalls über HTTPS ausgeliefert.

Medienliste

URLALT-AttributeTitel
/services/out/images/tcs_logo.svgtcs logologo tcs
/services/out/images/logo-ewh.pngewh logoewh logo
/services/out/images/tcs_logo_small.svgKein ALT-Attribut angegeben
/services/out/images/logo-small.pngewh logoewh logo
...es/out/images/dummy_telephone_header.jpgKein ALT-Attribut angegeben
...rogram/out/img/account_points_header.pngPOINTS
/services/out/images/lens0.pngKein ALT-Attribut angegeben
/services/out/images/login_mobile.pngKein ALT-Attribut angegeben
.../out/images/motiv-newsletter-inhalte.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svg08 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slideshow 1680x853 DESKTOP SET 6
/services/out/images/spinner.svg10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
...s/tchibo/images/dummys/icons/icon_05.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_06.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_01.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_02.jpgKein ALT-Attribut angegeben
...s/tchibo/images/dummys/icons/icon_03.jpgKein ALT-Attribut angegeben
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgPiacetto Caffè Crema Tradizionale, 1.000gPiacetto Caffè Crema Tradizionale, 1.000g
/services/out/images/spinner.svgPfefferminzePfefferminze
...s/content-slider/kaffeevollautomaten.pngkaffeevollautomatenkaffeevollautomaten
...ent-slider/kaffeevollautomaten-hover.pngkaffeevollautomaten hoverkaffeevollautomaten hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
...ontent-slider/filterkaffeemaschinen2.pngfilterkaffeemaschinen2filterkaffeemaschinen2
...t-slider/filterkaffeemaschinen-hover.pngfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/kapselmaschinen.pngkapselmaschinenkapselmaschinen
...content-slider/kapselmaschinen-hover.pngkapselmaschinen hoverkapselmaschinen hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/siebtraeger.pngsiebtraegersiebtraeger
...ets/content-slider/siebtraeger-hover.pngsiebtraeger hoversiebtraeger hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svgkaffeevollautomatenkaffeevollautomaten
/services/out/images/spinner.svgkaffeevollautomaten hoverkaffeevollautomaten hover
/services/out/images/spinner.svgfilterkaffeemaschinen2filterkaffeemaschinen2
/services/out/images/spinner.svgfilterkaffeemaschinen hoverfilterkaffeemaschinen hover
/services/out/images/spinner.svgkapselmaschinenkapselmaschinen
/services/out/images/spinner.svgkapselmaschinen hoverkapselmaschinen hover
/services/out/images/spinner.svgsiebtraegersiebtraeger
/services/out/images/spinner.svgsiebtraeger hoversiebtraeger hover
/services/out/images/spinner.svgCoffea CompactCoffea Compact
/services/out/images/spinner.svgCoffea IntenseCoffea Intense
/services/out/images/spinner.svgWMF 1100 SWMF 1100 S
/services/out/images/spinner.svgJura WE6 Piano Black (ohne Milchfunktion)Jura WE6 Piano Black (ohne Milchfunktion)
/services/out/images/spinner.svgJura WE8 Dark Inox (mit Milchfunktion)Jura WE8 Dark Inox (mit Milchfunktion)
/services/out/images/spinner.svgJura X6 Dark Inox (ohne Milchfunktion)Jura X6 Dark Inox (ohne Milchfunktion)
/services/out/images/spinner.svgStarterpaket "Feine Milde Bonamat"Starterpaket "Feine Milde Bonamat"
/services/out/images/spinner.svgBonamat THBonamat TH
/services/out/images/spinner.svgBusiness Line Typ 494Business Line Typ 494
/services/out/images/spinner.svgBusiness Line Pouch (Kaffee-Filterkissen)Business Line Pouch (Kaffee-Filterkissen)
/services/out/images/spinner.svgBusiness Line 494 Gratis-GestellungBusiness Line 494 Gratis-Gestellung
/services/out/images/spinner.svgStarterpaket "Feine Milde Business Line"Starterpaket "Feine Milde Business Line"
/services/out/images/spinner.svgEasy ProfessionalEasy Professional
/services/out/images/spinner.svgTWIN KapselautomatTWIN Kapselautomat
/services/out/images/spinner.svgBarista KapselautomatBarista Kapselautomat
/services/out/images/spinner.svgCafissimo Latte ProfessionalCafissimo Latte Professional
/services/out/images/spinner.svgStarterpaket "Siebträger"Starterpaket "Siebträger"
/services/out/images/spinner.svgExpobar Office Leva EB61, 2 BoilerExpobar Office Leva EB61, 2 Boiler
/services/out/images/spinner.svgWasserenthärter PatroneWasserenthärter Patrone
/services/out/images/spinner.svgCarimali KICCOCarimali KICCO
/services/out/images/spinner.svgWMF EspressoWMF Espresso
/assets/content-slider/ganze-bohne.pngganze bohneganze bohne
...ets/content-slider/ganze-bohne-hover.pngganze bohne hoverganze bohne hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/muehle.pngmuehlemuehle
/assets/content-slider/muehle-hover.pngmuehle hovermuehle hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/kapseln.pngkapselnkapseln
/assets/content-slider/kapseln-hover.pngkapseln hoverkapseln hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/assets/content-slider/tee-tasse.pngtee tassetee tasse
/assets/content-slider/tee-tasse-hover.pngtee tasse hovertee tasse hover
/themes/tchibo/images/arrows_m8.pngKein ALT-Attribut angegeben
/services/out/images/spinner.svgganze bohneganze bohne
/services/out/images/spinner.svgganze bohne hoverganze bohne hover
/services/out/images/spinner.svgmuehlemuehle
/services/out/images/spinner.svgmuehle hovermuehle hover
/services/out/images/spinner.svgkapselnkapseln
/services/out/images/spinner.svgkapseln hoverkapseln hover
/services/out/images/spinner.svgtee tassetee tasse
/services/out/images/spinner.svgtee tasse hovertee tasse hover
/services/out/images/spinner.svgTchibo Café Crème Classique, 500gTchibo Café Crème Classique, 500g
/services/out/images/spinner.svgTchibo Café Crème Suisse, 500gTchibo Café Crème Suisse, 500g
/services/out/images/spinner.svgTchibo Espresso Speciale, 500gTchibo Espresso Speciale, 500g
/services/out/images/spinner.svgEspresso Classico, 500gEspresso Classico, 500g
/services/out/images/spinner.svgTchibo Café Grande, 500gTchibo Café Grande, 500g
/services/out/images/spinner.svgTchibo Café Gourmet mild, Ganze Bohne, 500gTchibo Café Gourmet mild, Ganze Bohne, 500g
/services/out/images/spinner.svgFeine Milde Business Line 6x80gFeine Milde Business Line 6x80g
/services/out/images/spinner.svgFeine Milde Business Line 20x80gFeine Milde Business Line 20x80g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 6x80gTchibo Café Gourmet mild, 6x80g
/services/out/images/spinner.svgTchibo Café Gourmet mild, 500gTchibo Café Gourmet mild, 500g
/services/out/images/spinner.svgCafé Gourmet Elegant, 6x90gCafé Gourmet Elegant, 6x90g
/services/out/images/spinner.svgKombipaket "Filterkaffee 80g-Portionen"Kombipaket "Filterkaffee 80g-Portionen"
/services/out/images/spinner.svgPiacetto Caffè Crema Supremo, KapselnPiacetto Caffè Crema Supremo, Kapseln
/services/out/images/spinner.svgPiacetto Espresso Supremo, KapselnPiacetto Espresso Supremo, Kapseln
/services/out/images/spinner.svgKaffee kräftig, 10 KapselnKaffee kräftig, 10 Kapseln
/services/out/images/spinner.svgKaffee mild, 10 KapselnKaffee mild, 10 Kapseln
/services/out/images/spinner.svgCaffè Crema mild, 10 KapselnCaffè Crema mild, 10 Kapseln
/services/out/images/spinner.svgEspresso elegant, 10 KapselnEspresso elegant, 10 Kapseln
/services/out/images/spinner.svgTchibo Mehrwegbecher Gold, 36 StückTchibo Mehrwegbecher Gold, 36 Stück
/services/out/images/spinner.svgTchibo Mehrwegbecher Schwarz, 36 StückTchibo Mehrwegbecher Schwarz, 36 Stück
/services/out/images/spinner.svgFeldkräuterFeldkräuter
/services/out/images/spinner.svgApfel/BirneApfel/Birne
/services/out/images/spinner.svgPfefferminzePfefferminze
/services/out/images/spinner.svgFrüchtetee Hibiskus & HimbeereFrüchtetee Hibiskus & Himbeere
/assets/icons/icon-check-000000.pngicon check 000000
/assets/icons/icon-sprechblase-000000.pngicon sprechblase 000000
...ets/icons/icon-taschenrechner-000000.pngicon taschenrechner 000000
/assets/icons/icon-teetasse.pngicon teetasse
/assets/icons/icon-lampe.pngicon lampe
/assets/icons/icon-person.pngicon person
/assets/icons/icon-baum.pngicon baum
/services/out/images/spinner.svgKein ALT-Attribut angegeben
/services/out/images/spinner.svgKein ALT-Attribut angegeben
...es/out/images/dummy_telephone_header.jpgKein ALT-Attribut angegeben

Seitenstruktur

H1 Überschrift
(Extrem wichtig)
Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
Die H1-Überschrift ist perfekt.
Überschriften
(Wichtig)
Die Überschriftenstruktur ist fehlerfrei.

Überschriftenstruktur

Überschriften HierarchieInhalt
H1 Tchibo Coffee Service - Ihr Partner für die professionelle Kaffeeversorgung
H2 Systemlösungen für Ihren Kaffee-Ausschank
H2 Rundum-Versorgung für höchsten Genuss
H2 Tchibo Coffee Service – das Unternehmen
Baselink: https://www.tchibo-coffeeservice.de/
Einige der Linktexte der internen Links sind zu lang.
Die internen Links haben teilweise dynamische Parameter. Alle internen URLs, welche nicht als nofollow markiert sind, sollten keine dynamischen Parameter aufweisen.
Einige der Linktexte wiederholen sich.
1 Links haben keinen Linktext oder nur Inhalt in Alt- und Titelattributen.
Die Anzahl an internen Links ist ok.
Es befinden sich 14 externe Links auf der Seite.
LinkAttributeLinktext
/IMG-ALT tcs logo
https://www.espressowarehouse.de/Extern IMG-ALT ewh logo
/Kein Text
https://www.espressowarehouse.de/Extern Textduplikat IMG-ALT ewh logo
/kundendienst-und-support/Kundenservice
/ihre-vorteile/Ihre Vorteile
/praemien/IMG-ALT POINTS
/DE
/Germany
https://www.tchibo-coffeeservi...Extern Austria
https://www.tchibo-coffeeservi...Extern Poland
https://www.tchibo-coffeeservi...Extern Czech Republic
http://www.tchibo-coffee.co.uk/Extern United Kingdom
https://www.tchibo-coffeeservi...Extern Worldwide
/shop/warenkorb/Kein Text
/shop/mein-konto/Login
/shop/kaffee/Kaffee
/shop/ganze-bohne/Ganze Bohne
/shop/mahlkaffee/Mahlkaffee
/shop/kapseln/Kapseln
/shop/instant/Instant
/shop/to-go-zubehoer/To Go Zubehör
/shop/kaffee-im-abo/Kaffee im Abo
/feine-milde/Feine Milde fürs Büro
/shop/milch-zucker/Milch, Zucker & Gebäck
/shop/fair-trade/Fair Trade
/kaffee-akademie/Kaffee-Akademie
/shop/tchibo-kaffee/Tchibo
/shop/eduscho/Eduscho
/shop/piacetto-espresso/Piacetto
/davidoff-cafe/Davidoff
/shop/kaffeemaschinen/Kaffeemaschinen
/shop/kaffeevollautomaten/Kaffeevollautomaten
/shop/filterkaffeemaschinen/Filterkaffeemaschinen
/shop/kapselmaschinen/Kapselmaschinen
/shop/siebtraeger/Siebträger
/shop/kaffeemuehlen/Kaffeemühlen
/shop/reinigung/Reinigung
/kaffeevollautomaten-mieten-fi...Mieten / Finanzieren
/filterkaffeemaschine-gratisFilterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebraucht-Angebote
/shop/kaffeemaschinenzubehoer/Kaffeemaschinenzubehör
/shop/wmf-kaffeemaschinen/WMF
/shop/index.php?cl=alist&searc...Franke
/shop/moccamaster-kaffeemaschi...Moccamaster
/shop/jura-kaffeemaschinen/JURA
/shop/tee-mehr/Tee & mehr
/shop/tee/Tee
/shop/trinkschokolade/Trinkschokolade
/shop/milch-zucker/Textduplikat Milch, Zucker & Gebäck
/shop/geschirr-besteck/Geschirr & Besteck
/shop/to-go-zubehoer/Textduplikat To Go Zubehör
/shop/milchpulver-topping/Milchpulver & Topping
/shop/sirup-smoothies/Sirup
/shop/pure-tea/Pure Tea
/shop/pure-fine-selection/Pure Fine Selection
/shop/davinci/DaVinci
/shop/spar-angebote/% Sale
/shop/angebote/?attrfilter[C21...Textduplikat Kaffeemaschinen
/shop/angebote/?attrfilter[C21...Textduplikat Kaffee
/shop/angebote/?attrfilter[C21...Textduplikat Tee & mehr
/shop/angebote/?attrfilter[C21...Restposten
/filterkaffeemaschine-gratisTextduplikat Filterkaffeemaschine GRATIS
/gebrauchtekaffeevollautomaten/Gebrauchtmaschinen-Angebote
/1-19-mitarbeiter/Büros 1-19 Mitarbeiter
/ueber-20-mitarbeiter/Büros 20 + Mitarbeiter
/hotel/Hotels
/gastronomie/Gastronomie
/baeckerei/Bäckereien
/shop/maschinenfinder/Maschinenfinder
/kaffeevollautomaten-mieten-fi...Vollautomat mieten / finanzieren
/filterkaffeemaschine-gratisTextduplikat Filterkaffeemaschine GRATIS
/feine-milde/Textduplikat Feine Milde fürs Büro
/kaffee-akademie/Textduplikat Kaffee-Akademie
/inneneinrichtung/Einrichtungskonzepte
/praemien/Textduplikat POINTS
/kontakt/Kontakt
/infos-anfordern/Infos anfragen
/kontakt/Textduplikat Kontakt
/shop/newsletter/Newsletter
/shop/newsletter/Jetzt abonnieren
/kaffeevollautomaten-mieten-fi...IMG-ALT 08 TCS COMBI PACKAGES GENERAL TEASER FOCUS ORDER 23 Slideshow 1680x853 DESKTOP SET 6
/kaffeevollautomaten-mieten-fi...Kaffeevollautomat ab € 38 pro Monat mieten oder finanzieren Technischer Service vor Ort Flexible Vertragslaufzeiten Bis zu 25% Dauerrabatt auf Kaffee Jetzt i...
/filterkaffeemaschine-gratis/IMG-ALT 10 TCHIBO BUSINESS LINE Slideshow 1680x853 DESKTOP
/filterkaffeemaschine-gratis/Filterkaffeemaschine Gratis Inkl. 2 Pumpkannen Inkl. Austausch-Service Kaffee und Zubehör ab 7 Cent / Tasse Zum Angebot
/1-19-mitarbeiter/1-19 Mitarbeiter
/ueber-20-mitarbeiter/20 + Mitarbeiter
/gastronomie/Textduplikat Gastronomie
/hotel/Hotel
/baeckerei/Bäckerei
/shop/kaffeevollautomaten/Alle Kaffeevollautomaten anzeigen »
A-TITLE Alle Artikel
/shop/kaffeemaschinen/coffea-c...Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Versand
/shop/versand-zahlungsarten/Lieferdetails
/shop/kaffeemaschinen/coffea-c...Zum Produkt
/shop/kaffeemaschinen/coffea-c...In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeevollautomaten/Nofollow Alle Artikel
/shop/kaffee/Alle Kaffees anzeigen »
A-TITLE Alle Artikel
/shop/kaffee/piacetto-tradizio...Sie sparen 20 % Piacetto Caffè Crema Tradizionale, 1.000g
IMG-ALT Piacetto Caffè Crema Tradizionale, 1.000g
A-TITLE Piacetto Caffè Crema Tradizionale, 1.000g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/piacetto-tradizio...Textduplikat Zum Produkt
/shop/kaffee/piacetto-tradizio...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Nofollow Textduplikat Alle Artikel
/shop/tee/Alle Tees anzeigen »
A-TITLE Alle Artikel
/shop/tee/pure-tea-classics-pf...Pfefferminze
IMG-ALT Pfefferminze
A-TITLE Pfefferminze
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee/pure-tea-classics-pf...Textduplikat Zum Produkt
/shop/tee/pure-tea-classics-pf...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee/Nofollow Textduplikat Alle Artikel
/shop/kaffeevollautomaten/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Kaffeevollautomaten«
/shop/kaffeemaschinen/coffea-c...Textduplikat Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Compact
IMG-ALT Coffea Compact
A-TITLE Coffea Compact
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/coffea-c...Textduplikat Zum Produkt
/shop/kaffeemaschinen/coffea-c...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/coffea-i...Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT Coffea Intense
IMG-ALT Coffea Intense
A-TITLE Coffea Intense
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/coffea-i...Textduplikat Zum Produkt
/shop/kaffeemaschinen/coffea-i...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/wmf-1100...Kombi-Angebot + 25 % KAFFEE-DAUER-RABATT WMF 1100 S
IMG-ALT WMF 1100 S
A-TITLE WMF 1100 S
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/wmf-1100...Textduplikat Zum Produkt
/shop/kaffeemaschinen/wmf-1100...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/jura-we6...Jura WE6 Piano Black (ohne Milchfunktion)
IMG-ALT Jura WE6 Piano Black (ohne Milchfunktion)
A-TITLE Jura WE6 Piano Black (ohne Milchfunktion)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/jura-we6...Textduplikat Zum Produkt
/shop/kaffeemaschinen/jura-we6...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/jura-we8...Jura WE8 Dark Inox (mit Milchfunktion)
IMG-ALT Jura WE8 Dark Inox (mit Milchfunktion)
A-TITLE Jura WE8 Dark Inox (mit Milchfunktion)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/jura-we8...Textduplikat Zum Produkt
/shop/kaffeemaschinen/jura-we8...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/jura-x6-...Jura X6 Dark Inox (ohne Milchfunktion)
IMG-ALT Jura X6 Dark Inox (ohne Milchfunktion)
A-TITLE Jura X6 Dark Inox (ohne Milchfunktion)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/jura-x6-...Textduplikat Zum Produkt
/shop/kaffeemaschinen/jura-x6-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/filterkaffeemaschinen/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Filterkaffeemaschinen«
/shop/filterkaffeemaschinen/st...Sie sparen 170 € Starterpaket "Feine Milde Bonamat"
IMG-ALT Starterpaket "Feine Milde Bonamat"
A-TITLE Starterpaket "Feine Milde Bonamat"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/filterkaffeemaschinen/st...Textduplikat Zum Produkt
/shop/filterkaffeemaschinen/st...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/bonamat-...Sie sparen 35 % Bonamat TH
IMG-ALT Bonamat TH
A-TITLE Bonamat TH
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/bonamat-...Textduplikat Zum Produkt
/shop/kaffeemaschinen/bonamat-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/filterkaffeemaschinen/bu...Business Line Typ 494
IMG-ALT Business Line Typ 494
A-TITLE Business Line Typ 494
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/filterkaffeemaschinen/bu...Textduplikat Zum Produkt
/shop/kaffeemaschinen/business...Business Line Pouch (Kaffee-Filterkissen)
IMG-ALT Business Line Pouch (Kaffee-Filterkissen)
A-TITLE Business Line Pouch (Kaffee-Filterkissen)
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/business...Textduplikat Zum Produkt
/shop/kaffeemaschinen/business...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/filterkaffeemaschinen/bu...Maschine GRATIS Maschine GRATIS Business Line 494 Gratis-Gestellung
IMG-ALT Business Line 494 Gratis-Gestellung
A-TITLE Business Line 494 Gratis-Gestellung
/shop/filterkaffeemaschinen/bu...Textduplikat Zum Produkt
/maschinen-kontakt/?mk_article...Anfrage
A-TITLE Kontakt
/shop/filterkaffeemaschinen/st...Sie sparen 50 € Starterpaket "Feine Milde Business Line"
IMG-ALT Starterpaket "Feine Milde Business Line"
A-TITLE Starterpaket "Feine Milde Business Line"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/filterkaffeemaschinen/st...Textduplikat Zum Produkt
/shop/filterkaffeemaschinen/st...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kapselmaschinen/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Kapselmaschinen«
/shop/kapselmaschinen/easy-pro...6 Probier-Kapseln gratis Easy Professional
IMG-ALT Easy Professional
A-TITLE Easy Professional
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kapselmaschinen/easy-pro...Textduplikat Zum Produkt
/shop/kapselmaschinen/easy-pro...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kapselmaschinen/twin-kap...6 Probier-Kapseln gratis TWIN Kapselautomat
IMG-ALT TWIN Kapselautomat
A-TITLE TWIN Kapselautomat
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kapselmaschinen/twin-kap...Textduplikat Zum Produkt
/shop/kapselmaschinen/twin-kap...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kapselmaschinen/barista-...Probierkapseln gratis Barista Kapselautomat
IMG-ALT Barista Kapselautomat
A-TITLE Barista Kapselautomat
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kapselmaschinen/barista-...Textduplikat Zum Produkt
/shop/kapselmaschinen/barista-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/cafissim...Cafissimo Latte Professional
IMG-ALT Cafissimo Latte Professional
A-TITLE Cafissimo Latte Professional
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/cafissim...Textduplikat Zum Produkt
/shop/kaffeemaschinen/cafissim...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/siebtraeger/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Siebträger«
/shop/kaffeemaschinen/starterp...Sie sparen 150 € Starterpaket "Siebträger"
IMG-ALT Starterpaket "Siebträger"
A-TITLE Starterpaket "Siebträger"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/starterp...Textduplikat Zum Produkt
/shop/kaffeemaschinen/starterp...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/expobar-...Expobar Office Leva EB61, 2 Boiler
IMG-ALT Expobar Office Leva EB61, 2 Boiler
A-TITLE Expobar Office Leva EB61, 2 Boiler
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinen/expobar-...Textduplikat Zum Produkt
/shop/kaffeemaschinen/expobar-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinenzubehoer/...Wasserenthärter Patrone
IMG-ALT Wasserenthärter Patrone
A-TITLE Wasserenthärter Patrone
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffeemaschinenzubehoer/...Textduplikat Zum Produkt
/shop/kaffeemaschinenzubehoer/...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffeemaschinen/carimali...Carimali KICCO
IMG-ALT Carimali KICCO
A-TITLE Carimali KICCO
/shop/kaffeemaschinen/carimali...Textduplikat Zum Produkt
/maschinen-kontakt/?mk_article...Textduplikat Anfrage
A-TITLE Kontakt
/shop/kaffeemaschinen/wmf-espr...WMF Espresso
IMG-ALT WMF Espresso
A-TITLE WMF Espresso
/shop/kaffeemaschinen/wmf-espr...Textduplikat Zum Produkt
/maschinen-kontakt/?mk_article...Textduplikat Anfrage
A-TITLE Kontakt
/shop/ganze-bohne/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Ganze Bohne«
/shop/kaffee/tchibo-cafe-creme...Sie sparen 20 % Tchibo Café Crème Classique, 500g
IMG-ALT Tchibo Café Crème Classique, 500g
A-TITLE Tchibo Café Crème Classique, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-creme...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-creme...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-cafe-creme...Sie sparen 20 % Tchibo Café Crème Suisse, 500g
IMG-ALT Tchibo Café Crème Suisse, 500g
A-TITLE Tchibo Café Crème Suisse, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-creme...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-creme...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-espresso-s...Sie sparen 20 % Tchibo Espresso Speciale, 500g
IMG-ALT Tchibo Espresso Speciale, 500g
A-TITLE Tchibo Espresso Speciale, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-espresso-s...Textduplikat Zum Produkt
/shop/kaffee/tchibo-espresso-s...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-espresso-c...Sie sparen 20 % Espresso Classico, 500g
IMG-ALT Espresso Classico, 500g
A-TITLE Espresso Classico, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-espresso-c...Textduplikat Zum Produkt
/shop/kaffee/tchibo-espresso-c...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-cafe-grand...Sie sparen 20 % Tchibo Café Grande, 500g
IMG-ALT Tchibo Café Grande, 500g
A-TITLE Tchibo Café Grande, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-grand...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-grand...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/cafe-gourmet-mild...Sie sparen 20 % Tchibo Café Gourmet mild, Ganze Bohne, 500g
IMG-ALT Tchibo Café Gourmet mild, Ganze Bohne, 500g
A-TITLE Tchibo Café Gourmet mild, Ganze Bohne, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/cafe-gourmet-mild...Textduplikat Zum Produkt
/shop/kaffee/cafe-gourmet-mild...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/mahlkaffee/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Mahlkaffee«
/shop/kaffee/feine-milde-busin...Feine Milde Business Line 6x80g
IMG-ALT Feine Milde Business Line 6x80g
A-TITLE Feine Milde Business Line 6x80g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/feine-milde-busin...Textduplikat Zum Produkt
/shop/kaffee/feine-milde-busin...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/feine-milde-busin...Feine Milde Business Line 20x80g
IMG-ALT Feine Milde Business Line 20x80g
A-TITLE Feine Milde Business Line 20x80g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/feine-milde-busin...Textduplikat Zum Produkt
/shop/kaffee/feine-milde-busin...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-cafe-gourm...Sie sparen 20 % Tchibo Café Gourmet mild, 6x80g
IMG-ALT Tchibo Café Gourmet mild, 6x80g
A-TITLE Tchibo Café Gourmet mild, 6x80g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-gourm...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-gourm...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-cafe-gourm...Sie sparen 20 % Tchibo Café Gourmet mild, 500g
IMG-ALT Tchibo Café Gourmet mild, 500g
A-TITLE Tchibo Café Gourmet mild, 500g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-gourm...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-gourm...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/tchibo-cafe-gourm...Sie sparen 20 % Café Gourmet Elegant, 6x90g
IMG-ALT Café Gourmet Elegant, 6x90g
A-TITLE Café Gourmet Elegant, 6x90g
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/tchibo-cafe-gourm...Textduplikat Zum Produkt
/shop/kaffee/tchibo-cafe-gourm...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/mahlkaffee/kombipaket-fi...90 Korbfilter gratis Kombipaket "Filterkaffee 80g-Portionen"
IMG-ALT Kombipaket "Filterkaffee 80g-Portionen"
A-TITLE Kombipaket "Filterkaffee 80g-Portionen"
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/mahlkaffee/kombipaket-fi...Textduplikat Zum Produkt
/shop/mahlkaffee/kombipaket-fi...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kapseln/Textduplikat Alle Artikel
A-TITLE Alle Artikel in »Kapseln«
/shop/kaffee/piacetto-supremo-...Piacetto Caffè Crema Supremo, Kapseln
IMG-ALT Piacetto Caffè Crema Supremo, Kapseln
A-TITLE Piacetto Caffè Crema Supremo, Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/piacetto-supremo-...Textduplikat Zum Produkt
/shop/kaffee/piacetto-supremo-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/piacetto-supremo-...Piacetto Espresso Supremo, Kapseln
IMG-ALT Piacetto Espresso Supremo, Kapseln
A-TITLE Piacetto Espresso Supremo, Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/piacetto-supremo-...Textduplikat Zum Produkt
/shop/kaffee/piacetto-supremo-...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/kaffee-kraeftig-1...Kaffee kräftig, 10 Kapseln
IMG-ALT Kaffee kräftig, 10 Kapseln
A-TITLE Kaffee kräftig, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/kaffee-kraeftig-1...Textduplikat Zum Produkt
/shop/kaffee/kaffee-kraeftig-1...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kapseln/kaffee-mild-10-k...Kaffee mild, 10 Kapseln
IMG-ALT Kaffee mild, 10 Kapseln
A-TITLE Kaffee mild, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kapseln/kaffee-mild-10-k...Textduplikat Zum Produkt
/shop/kapseln/kaffee-mild-10-k...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/cafissimo-caffe-c...Caffè Crema mild, 10 Kapseln
IMG-ALT Caffè Crema mild, 10 Kapseln
A-TITLE Caffè Crema mild, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/cafissimo-caffe-c...Textduplikat Zum Produkt
/shop/kaffee/cafissimo-espress...Espresso elegant, 10 Kapseln
IMG-ALT Espresso elegant, 10 Kapseln
A-TITLE Espresso elegant, 10 Kapseln
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/kaffee/cafissimo-espress...Textduplikat Zum Produkt
/shop/kaffee/cafissimo-espress...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee-mehr/tchibo-mehrwegb...Tchibo Mehrwegbecher Gold, 36 Stück
IMG-ALT Tchibo Mehrwegbecher Gold, 36 Stück
A-TITLE Tchibo Mehrwegbecher Gold, 36 Stück
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee-mehr/tchibo-mehrwegb...Textduplikat Zum Produkt
/shop/tee-mehr/tchibo-mehrwegb...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee-mehr/tchibo-mehrwegb...Tchibo Mehrwegbecher Schwarz, 36 Stück
IMG-ALT Tchibo Mehrwegbecher Schwarz, 36 Stück
A-TITLE Tchibo Mehrwegbecher Schwarz, 36 Stück
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee-mehr/tchibo-mehrwegb...Textduplikat Zum Produkt
/shop/pure-tea/feldkraeuter.htmlFeldkräuter
IMG-ALT Feldkräuter
A-TITLE Feldkräuter
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/pure-tea/feldkraeuter.htmlTextduplikat Zum Produkt
/shop/tee-mehr/apfel-birne.htmlApfel/Birne
IMG-ALT Apfel/Birne
A-TITLE Apfel/Birne
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee-mehr/apfel-birne.htmlTextduplikat Zum Produkt
/shop/tee-mehr/apfel-birne.htm...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee/pure-tea-classics-pf...Textduplikat Pfefferminze
IMG-ALT Pfefferminze
A-TITLE Pfefferminze
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee/pure-tea-classics-pf...Textduplikat Zum Produkt
/shop/tee/pure-tea-classics-pf...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/tee/pure-tea-classics-fr...Früchtetee Hibiskus & Himbeere
IMG-ALT Früchtetee Hibiskus & Himbeere
A-TITLE Früchtetee Hibiskus & Himbeere
/shop/versand-zahlungsarten/Textduplikat Versand
/shop/versand-zahlungsarten/Textduplikat Lieferdetails
/shop/tee/pure-tea-classics-fr...Textduplikat Zum Produkt
/shop/tee/pure-tea-classics-fr...Textduplikat In den Warenkorb
A-TITLE In den Warenkorb
/shop/kaffee/Kaffeespezialitäten
/shop/kaffeevollautomaten/Textduplikat Kaffeevollautomaten
/shop/filterkaffeemaschinen/Textduplikat Filterkaffeemaschinen
/shop/tee-mehr/Kaffee- und Teeprodukten
/kundendienst-und-supportServicekonzepte
/shop/maschinenfinder/optimal für Sie geeigneten Maschine
/ihre-vorteile/Textduplikat Ihre Vorteile
/kundendienst-und-support/Textduplikat Kundenservice
/kontakt/Textduplikat Kontakt
/infos-anfordern/Textduplikat Infos anfragen
/shop/agb/AGB
/shop/versand-zahlungsarten/Lieferung & Zahlung
/shop/widerrufsrecht/Widerrufsrecht
/shop/out/zoxidflat/media/Tchi...Widerrufsformular
/shop/datenschutz/Datenschutz
/shop/impressum/Impressum
/unternehmen/Unternehmen
http://karriere.tchibo-coffees...Extern Subdomain Karriere
/faqsFAQ
/Textduplikat DE
/Textduplikat Germany
https://www.tchibo-coffeeservi...Extern Textduplikat Austria
https://www.tchibo-coffeeservi...Extern Textduplikat Poland
https://www.tchibo-coffeeservi...Extern Textduplikat Czech Republic
http://www.tchibo-coffee.co.uk/Extern Textduplikat United Kingdom
https://www.tchibo-coffeeservi...Extern Textduplikat Worldwide
https://www.tchibo.de/Extern Tchibo.de

Serverkonfiguration

HTTP-Weiterleitungen
(Extrem wichtig)
Die Seite leitet weiter auf "https://www.tchibo-coffeeservice.de/"
HTTP-Header
(Wichtig)
Es wird kein X-Powered HTTP-Header mitgesendet.
Der Webserver nutzt GZip zur komprimierten Übertragung der Webseite (HTML).
Performance
(Wenig wichtig)
Die Antwortzeit der HTML-Seite ist mit 3,03 Sekunden extrem langsam. Ein angepeiltes Ziel sollten 0,4 Sekunden sein. Suchmaschinen-Crawler können sonst Inhalte nicht so schnell aufnehmen und auch Besucher erwarten eine schnelle Webseite.
Die Webseite lädt 14 CSS Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Webseite lädt 25 Javascript Dateien, dies kann die Ladezeit negativ beeinträchtigen.
Die Dateigröße des HTML-Dokuments ist mit 391 kB in Ordnung.

HTTP-Header

NameWert
servernginx
dateSun, 26 Jan 2020 10:29:58 GMT
content-typetext/html; charset=utf-8
content-length32413
connectionkeep-alive
varyAccept-Encoding
set-cookie54 Zeichen
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-cache, no-store, must-revalidate
pragmano-cache
x-dynamiccachemiss at Sun, 26 Jan 2020 11:29:55 +0100
last-modifiedMon, 02 Dec 2019 07:55:50 GMT
content-encodinggzip
x-sc-app10.3.120.11:80
x-sc-lb10.3.120.9
statuscode200
http_versionHTTP/1.1

Externe Faktoren

Blacklists
(Extrem wichtig)
Die Seite wird von Webwiki nicht als "nur für Erwachsene" eingestuft.
Die Seite ist nicht auf der Shallalist verzeichnet.
Die Seite wird von Wikipedia verlinkt.
Die Seite ist exzellent von anderen Webseiten verlinkt.
Die Seite hat Backlinks von 377 verweisenden Domains.
Die Seite hat insgesamt 29.593 Backlinks.
Die Seite hat Backlinks von 334 verschiedenen IP Adressen.
Verbreitung bei Facebook
(Wenig wichtig)
Die Seite hat viele Shares, Kommentare und Likes auf Facebook.
Eintrag bei Webwiki
(Nice to have)
Die Seite ist bei Webwiki verzeichnet.

Robots.txt

# For all robots
User-agent: *
Disallow: *searchparam*
Disallow: *cnid*
Disallow: *listtype*
Disallow: *ldtype*
Disallow: *force_sid*
Disallow: *addcompare*
Noindex: *searchparam*
Noindex: *cnid*
Noindex: *listtype*
Noindex: *ldtype*
Noindex: *force_sid*
Noindex: *addcompare*
Sitemap: https://www.tchibo-coffeeservice.de/shop/sitemaps/sitemap-index.xml
Disallow: /tchibo-smartcoffee/tchibo-smartcoffee-formular/

Popularität bei Facebook

Shares / Likes / Kommentare
376

Es werden nur die Daten zu der angegebenen URL abgefragt und nicht zu einer eventuell vorhandenen und auf der Seite verlinkten Facebook Seite.

Suchvorschau

Kaffeemaschinen mieten & leasen | Tchibo Coffee Service
https://www.tchibo-coffeeservice.de/
Finden Sie die besten Produkte für Ihre Kaffeeküche ✓ einzigartige Vielfalt an Kaffeemaschinen, erlesenem Tee und Kaffee ➤ Kostenlose Beratung ✓ Schneller Versand

Wichtigste Suchbegriffe

Folgende Keywords hat Seobility erkannt. Überprüfe die Optimierung dieser Keywords für Deine Seite.

KeywordErgebnisPrüfen
Kaffee80%Check
Tchibo78%Check
Tchibo Coffee Service76%Check
Kaffee Maschinen70%Check
Kaffeemaschinen56%Check
Kaffee Vollautomaten56%Check
Kaffee und Tee55%Check
Kaffee Genuss54%Check
Tchibo Mehrwegbecher53%Check
Bio Kaffee52%Check

Analysiere jetzt kostenlos bis zu 1.000 Unterseiten von tchibo-coffeeservice.de!

Kostenlos registrieren
Die Nutzung des Basis Accounts ist zeitlich unbegrenzt möglich