Thefergusonclinic.com - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
80% 
Page quality
92% 
Page structure
35% 
Link structure
7% 
Server
95% 
External factors
100% 
SEO Score
Response time
2.91 s
File size
307.50 kB
Words
1801
Media files
66
Number of links
163 internal / 45 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Cosmetic Plastic Surgery | Honolulu, HI
The length of the page title is perfect. (352 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Looking for plastic surgery Oahu? The Ferguson Clinic's state-of-the-art cosmetic plastic surgery center & medspa covers all your aesthetic needs in the heart of Honolulu, Hawaii.
The meta description is too long: 1098 pixels from max. 1000 pixels. Optimize description
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.thefergusonclinic.com/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: en
Language defined in HTML: en-us
Server location: United States of America
The following language is defined by HTML: en-us
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain name is very long.
The domain is no subdomain.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0
robotsindex, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
descriptionLooking for plastic surgery Oahu? The Ferguson Clinic's state-of-the-art cosmetic plastic surgery center & medspa covers all your aesthetic needs in the heart of Honolulu, Hawaii.
generatorSite Kit by Google 1.149.1
google-site-verificationsJXvp-RjXlkFMQmRV-g81xZvabCI1Oq4HlyCZBgNb9c
google-adsense-platform-accountca-host-pub-2644536267352236
google-adsense-platform-domainsitekit.withgoogle.com
msapplication-TileImagehttps://i0.wp.com/www.thefergusonclinic.com/wp-content/uploads/2024/07/cropped-cropped-fav.webp?fit=270%2C270&ssl=1
article:publisherhttp://www.facebook.com/thefergusonclinic
article:modified_time2025-03-14T20:05:11+00:00
langen-us
twitter:cardsummary_large_image
fb:app_id168955385827073
og:localeen_US
og:typewebsite
og:titleCosmetic Plastic Surgery | Honolulu, HI
og:descriptionLooking for plastic surgery Oahu? The Ferguson Clinic's state-of-the-art cosmetic plastic surgery center & medspa covers all your aesthetic needs in the heart of Honolulu, Hawaii.
og:urlhttps://www.thefergusonclinic.com/
og:site_nameThe Ferguson Clinic
og:imagehttps://www.thefergusonclinic.com/wp-content/uploads/2024/07/drferguson-_1_.avif
X-UA-CompatibleIE=edge
charsetUTF-8

Automatically check thefergusonclinic.com including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Page quality

Content
(Critically important)
There are 2 text duplicates on this page:
  • Duplicate: The Ferguson Clinic has consistently ranked in the top for best plasti...
This page contains 1801 words. That's ok.
33% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
Words from the H1 heading are used in the page content.
The page contains a listing, which indicates a good text layout.
19 paragraphs were found on this page.
The text content is perfect.
No placeholders texts or images were found.
The average number of words per sentence of 14.47 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1.0" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The following tag is repeated too often: includes:
Image SEO
(Somewhat important)
2 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
This page is optimized perfectly for social networks.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/wp-content/uploads/2020/10/logo.pnglogologo
...content/uploads/2020/10/logo-300x131.pnglogo
...Clinic-CBI-copy.png?resize=300,120&ssl=1cropped The Ferguson Clinic CBI copycropped The Ferguson Clinic CBI copy
...c-surgery-oahu.webp?resize=600,529&ssl=1hero plastic surgery oahuhero plastic surgery oahu
...c-surgery-oahu.webp?resize=300,265&ssl=1hero plastic surgery oahuhero plastic surgery oahu
...r-service-badge.png?resize=300,300&ssl=1customer service badgecustomer service badge
...s/2024/07/skin-e1695239256927-_1_-1.avifskin
...loads/2023/11/breast-e1695238990774.avifbreast e
...uploads/2023/11/face-e1695239193586.avifface e
...uploads/2023/11/body-e1695239080318.avifbody e
...s/2024/07/skin-e1695239256927-_1_-1.avifskin
...loads/2023/11/breast-e1695238990774.avifbreast e
...uploads/2023/11/face-e1695239193586.avifface e
...uploads/2023/11/body-e1695239080318.avifbody e
...he-art-cosmetic-surgery-clinic.png?ssl=1State-of-the-art-cosmetic-surgery-clinic.pngState-of-the-art-cosmetic-surgery-clinic.png
...tandard-of-care.png?resize=300,300&ssl=1Highest standard of careHighest standard of care
...alized-approach.png?resize=300,300&ssl=1Personalized approachPersonalized approach
...gery-techniques.png?resize=300,300&ssl=1Innovative cosmetic plastic surgery techniquesInnovative cosmetic plastic surgery techniques
...tent/uploads/2024/07/drferguson-_1_.avifdrfergusondrferguson
...23/08/logo-abcs.png?resize=171,128&ssl=1logo abcslogo abcs
...23-08-09-163533.png?resize=536,127&ssl=1Screenshot 2023 08 09 163533Screenshot 2023 08 09 163533
.../08/ablslogo600.jpg?resize=600,127&ssl=1American board laser surgery logoAmerican board laser surgery logo
...decorative-logo.jpg?resize=256,200&ssl=1american board otolaryngology head neck surgery logoamerican board otolaryngology head neck surgery logo
...PRS-Logo-1.png.webp?resize=200,200&ssl=1ABFPRS Logo 1.pngABFPRS Logo 1.png
...23-08-09-163533.png?resize=536,127&ssl=1Screenshot 2023 08 09 163533Screenshot 2023 08 09 163533
...decorative-logo.jpg?resize=256,200&ssl=1american board otolaryngology head neck surgery logoamerican board otolaryngology head neck surgery logo
...PRS-Logo-1.png.webp?resize=200,200&ssl=1ABFPRS Logo 1.pngABFPRS Logo 1.png
.../08/ablslogo600.jpg?resize=600,127&ssl=1American board laser surgery logoAmerican board laser surgery logo
...23/08/logo-abcs.png?resize=171,128&ssl=1logo abcslogo abcs
...care-logo-horiz.webp?resize=300,81&ssl=1outcare logo horizoutcare logo horiz
...4/05/sabestof22.png?resize=228,221&ssl=1sabestofsabestof
...024/05/2023kitv.png?resize=369,369&ssl=1kitvkitv
...24/05/hnltopdoc.png?resize=526,277&ssl=1hnltopdochnltopdoc
.../khon-10032016.webp?resize=463,236&ssl=1khonkhon
...4/05/kddb-cover.png?resize=200,200&ssl=1kddb coverkddb cover
...4/05/sabestof22.png?resize=100,100&ssl=1sabestofsabestof
...24/05/hnltopdoc.png?resize=300,158&ssl=1hnltopdochnltopdoc
...024/05/2023kitv.png?resize=100,100&ssl=1kitvkitv
...are-logo-horiz.webp?resize=594,161&ssl=1outcare logo horizoutcare logo horiz
...nt/plugins/bb-plugin/img/pixel.png?ssl=1No alt attribute provided
...4/05/kddb-cover.png?resize=100,100&ssl=1kddb coverkddb cover
...nt/plugins/bb-plugin/img/pixel.png?ssl=1No alt attribute provided
...s/2022/04/quote.png?resize=200,200&ssl=1quotequote
...ontent/uploads/2023/11/Banner-faces.avifmedspa hawaii bannermedspa hawaii banner
...n-logo-black-1.webp?resize=300,141&ssl=1allergan logo blackallergan logo black
...Web-Size_Retina.webp?resize=300,51&ssl=1RohrerLogo Web Size RetinaRohrerLogo Web Size Retina
...24/10/btl-logo.webp?resize=300,140&ssl=1btl logobtl logo
.../zo-skin-health.webp?resize=300,84&ssl=1zo skin healthzo skin health
...inceutical-logo.webp?resize=300,42&ssl=1skinceutical logoskinceutical logo
.../10/logo-inmode.webp?resize=292,36&ssl=1logo inmodelogo inmode
.../10/VIPBanner.png?resize=3456,1728&ssl=1VIPBanner
/wp-content/uploads/2024/08/botox.avifbotox
/wp-content/uploads/2024/08/botox.avifbotox
...0/silverwoman3.png?resize=1283,773&ssl=1silverwoman
...0/silverwoman3.png?resize=1283,773&ssl=1silverwoman
/wp-content/uploads/2024/08/gold.avifgold
/wp-content/uploads/2024/08/gold.avifgold
/wp-content/uploads/2024/08/platinum.avifplatinum
/wp-content/uploads/2024/08/platinum.avifplatinum
...e1741982487548.png?resize=1413,562&ssl=1patientfi
...ntent/uploads/2024/08/implantfiller.avifimplantfiller
...ntent/uploads/2024/03/depositinject.avifdepositinject
...ent/uploads/2025/03/springawakening.avifspringawakening
...uploads/2024/07/cropped-fav-150x150.webpcropped favcropped fav
...ntent/uploads/2018/07/tfc-bdh-circle.pngtfc-bdh circletfc-bdh circle

Page structure

H1 heading
(Critically important)
Beauty Defined Hawaii
Too many H1 headings
Headings
(Important)
Some headings occur twice on the page.
There are 36 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 Beauty Defined Hawaii
H1 Silver Membership
H2 State-of-the-art Cosmetic Plastic Surgery Center & MedSpa in Honolulu
H2 The Proven paradigm in Hawaii aesthetic care.
H2 Our Cosmetic Plastic Surgery Specialties
H2 Skin Correction
H2 Breast Enhancement
H2 Facial Rejuvenation
H2 Body Sculpting
H2 The Ferguson Difference.
H2 Board Certification & Recognition
H2 Top Cosmetic Surgeon On Oahu
H2 Top Cosmetic Surgeon On Oahu Duplicate text
H2 Patient Testimonials
H2 Beauty Defined Hawaii Medspa
H2 Featured Products & Services
H2 Tox Membership
H2 Gold Membership
H2 Platinum Membership
H2 Monthly Specials
H2 Breast Augmentation (Injectable Addon)
H2 Injectable Deposit
H2 Spring Awakening: Eye Enhancement Package
H2 Tranquil Mountain & Ocean views in Kaka’ako, Honolulu
H3 Breast Augmentation Breast Lift Nipple Repair
H3 Facelift Brows & Forehead Eyelid Surgery Ears Nose Neck Treatment
H3 Smartlipo Tummy Tuck Body Lifts Arm Lifts Thigh Lifts
H3 Location:
H3 Hours:
H3 Contact:
H3 The Ferguson Clinic
H3 Beauty Defined
H4 Skin Correction Duplicate text
H4 Breast
H4 Face
H4 Body Sculpting Duplicate text
Some internal links have dynamic parameters. All internal URLs, which are not marked as nofollow, should not contain dynamic parameters.
Some anchor texts are used more than once.
The number of internal links is ok.
None of the anchor texts is too long.
There are too many external links (45) on this page.

Found links on this page

LinkAttributesAnchor text
/Anchor Skip to content
https://www.google.com/maps/pl...New window External Subdomain 677 Ala Moana Blvd #1011 Honolulu (Kaka'ako)
/cdn-cgi/l/email-protection[email protected]
/product-category/concerns/acne/Subdomain • Acne
/product-category/concerns/fin...Subdomain • Fine Lines & Wrinkles
/product-category/concerns/mel...Subdomain • Melasma & Dark Spots
/product-category/concerns/loo...Subdomain • Loose Skin
/product-category/concerns/sun...Subdomain • Sun Damage
/product-category/medspa/body/Subdomain • Body Treatments
/hair-restoration/Subdomain Hair
/cosmetic-plastic-surgery-hono...Subdomain Breast Augmentation
/cosmetic-plastic-surgery-hono...Subdomain Breast Lift Hawaii
/nipple-repair-surgery/Subdomain Nipple Repair Surgery
/cosmetic-plastic-surgery-hono...Subdomain Liposuction
/cosmetic-plastic-surgery-hono...Subdomain SmartLipo
/non-invasive-lipo/Subdomain Non-Invasive Lipo
/cosmetic-plastic-surgery-hono...Subdomain Tummy Tuck
/mommymakeover/mommy-makeover-...Subdomain Mommy Makeover
/product/semaglutide/Subdomain Weight Loss/Fat Reduction
/facelift/Subdomain Facelift
/cosmetic-plastic-surgery-hono...Subdomain Brows and Forehead
/eyelid-surgery/Subdomain Eyelid Surgery
/emface/Subdomain EmFace
/ears/Subdomain Ears
/nose/Subdomain Nose
/neck-treatment/Subdomain Neck Treatment
/resources/Subdomain Resources
/contact/Subdomain Contact
/dr-ferguson/Subdomain Meet Dr.Ferguson
/our-team/Subdomain Our Team
/blog/Subdomain Blog
/financing/Subdomain Financing
/read-reviews/Subdomain Read Reviews
/medspa/Subdomain MedSpa
/medspa/Anchor Rewards Program
/product-category/medspa/laser/Subdomain Laser
/laser-hair-removal/Subdomain Laser Hair Removal
/product-category/medspa/hydra...Subdomain Hydrafacials
/filler/Subdomain Cosmetic Filler
/botoxinjections/Subdomain BOTOX®
/product-category/medspa/facia...Subdomain • Facial Treatment
/product-category/medspa/chemi...Subdomain Chemical Peels
/product-category/medspa/skin-...Subdomain Skin Care
/product-category/non-invasive/Subdomain Non-Invasive
/product-category/medspa/medsp...Subdomain Shop
/product-category/medspa/medsp...Subdomain MedSpa Specials
/product/custom-order/Subdomain Custom Order
/product/injectable-deposit/Subdomain Injectable Deposit
/book-online/Subdomain Book Online
/?page_id=16341Subdomain 0 items
A-TITLE Start shopping
/Subdomain IMG-ALT logo
/product-category/concerns/acne/Subdomain Text duplicate • Acne
/product-category/concerns/fin...Subdomain Text duplicate • Fine Lines & Wrinkles
/product-category/concerns/mel...Subdomain Text duplicate • Melasma & Dark Spots
/product-category/concerns/loo...Subdomain Text duplicate • Loose Skin
/product-category/concerns/sun...Subdomain Text duplicate • Sun Damage
/product-category/medspa/body/Subdomain Text duplicate • Body Treatments
/hair-restoration/Subdomain Text duplicate Hair
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate Breast Augmentation
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate Breast Lift Hawaii
/nipple-repair-surgery/Subdomain Text duplicate Nipple Repair Surgery
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate Liposuction
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate SmartLipo
/non-invasive-lipo/Subdomain Text duplicate Non-Invasive Lipo
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate Tummy Tuck
/mommymakeover/mommy-makeover-...Subdomain Text duplicate Mommy Makeover
/product/semaglutide/Subdomain Text duplicate Weight Loss/Fat Reduction
/facelift/Subdomain Text duplicate Facelift
/cosmetic-plastic-surgery-hono...Subdomain Text duplicate Brows and Forehead
/eyelid-surgery/Subdomain Text duplicate Eyelid Surgery
/emface/Subdomain Text duplicate EmFace
/ears/Subdomain Text duplicate Ears
/nose/Subdomain Text duplicate Nose
/neck-treatment/Subdomain Text duplicate Neck Treatment
/resources/Subdomain Text duplicate Resources
/contact/Subdomain Text duplicate Contact
/dr-ferguson/Subdomain Text duplicate Meet Dr.Ferguson
/our-team/Subdomain Text duplicate Our Team
/blog/Subdomain Text duplicate Blog
/financing/Subdomain Text duplicate Financing
/read-reviews/Subdomain Text duplicate Read Reviews
/Subdomain Text duplicate IMG-ALT logo
/medspa/Subdomain Text duplicate MedSpa
/medspa/Anchor Text duplicate Rewards Program
/product-category/medspa/laser/Subdomain Text duplicate Laser
/laser-hair-removal/Subdomain Text duplicate Laser Hair Removal
/product-category/medspa/hydra...Subdomain Text duplicate Hydrafacials
/filler/Subdomain Text duplicate Cosmetic Filler
/botoxinjections/Subdomain Text duplicate BOTOX®
/product-category/medspa/facia...Subdomain Text duplicate • Facial Treatment
/product-category/medspa/chemi...Subdomain Text duplicate Chemical Peels
/product-category/medspa/skin-...Subdomain Text duplicate Skin Care
/product-category/non-invasive/Subdomain Text duplicate Non-Invasive
/product-category/medspa/medsp...Subdomain Text duplicate Shop
/product-category/medspa/medsp...Subdomain Text duplicate MedSpa Specials
/product/custom-order/Subdomain Text duplicate Custom Order
/product/injectable-deposit/Subdomain Text duplicate Injectable Deposit
/book-online/Subdomain Text duplicate Book Online
/?page_id=16341Subdomain Text duplicate 0 items
A-TITLE Start shopping
/our-team/New window Subdomain Learn More About Us
/product-category/concerns/fin...New window Subdomain Skin Correction Botox Fillers Spa Services - Face & Body Laser Resurfacing
IMG-ALT skin
/botox/Botox
/fillers/Fillers
http://beautydefined.net/New window External Spa Services - Face & Body
/which-is-better-erbium-yag-la...Subdomain Laser Resurfacing
/breast-augmentation/New window Subdomain Breast Enhancement Breast Augmentation Breast Lift Nipple Repair
IMG-ALT breast e
/breast-augmentation/Text duplicate Breast Augmentation
/breast-lift/Breast Lift
/nipple-repair/Nipple Repair
/facelift/New window Subdomain Facial Rejuvenation Facelift Brows & Forehead Eyelid Surgery Ears Nose Neck Treatment
IMG-ALT face e
/facelift/Text duplicate Facelift
/brows-and-forehead/Brows & Forehead
/eyelid-surgery/Text duplicate Eyelid Surgery
/ears/Text duplicate Ears
/nose/Text duplicate Nose
/neck-treatment/Text duplicate Neck Treatment
/mommymakeover/New window Subdomain Body Sculpting Smartlipo Tummy Tuck Body Lifts Arm Lifts Thigh Lifts
IMG-ALT body e
/smartlipo/Smartlipo
/tummy-tuck/Text duplicate Tummy Tuck
/abdominoplasty-lower-body-lift/Subdomain Body Lifts
/weight-loss-skin-removal/Subdomain Arm Lifts
/weight-loss-skin-removal/Subdomain Thigh Lifts
/product-category/concerns/fin...New window Subdomain Text duplicate Skin Correction Botox Fillers Spa Services - Face & Body Laser Resurfacing
IMG-ALT skin
/botox/Text duplicate Botox
/fillers/Text duplicate Fillers
http://beautydefined.net/New window External Text duplicate Spa Services - Face & Body
/which-is-better-erbium-yag-la...Subdomain Text duplicate Laser Resurfacing
/breast-augmentation/New window Subdomain Breast Breast Augmentation Breast Lift Nipple Repair
IMG-ALT breast e
/breast-augmentation/Text duplicate Breast Augmentation
/breast-lift/Text duplicate Breast Lift
/nipple-repair/Text duplicate Nipple Repair
/facelift/New window Subdomain Face Facelift Brows & Forehead Eyelid Surgery Ears Nose Neck Treatment
IMG-ALT face e
/facelift/Text duplicate Facelift
/brows-and-forehead/Text duplicate Brows & Forehead
/eyelid-surgery/Text duplicate Eyelid Surgery
/ears/Text duplicate Ears
/nose/Text duplicate Nose
/neck-treatment/Text duplicate Neck Treatment
/mommymakeover/New window Subdomain Text duplicate Body Sculpting Smartlipo Tummy Tuck Body Lifts Arm Lifts Thigh Lifts
IMG-ALT body e
/smartlipo/Text duplicate Smartlipo
/tummy-tuck/Text duplicate Tummy Tuck
/abdominoplasty-lower-body-lift/Subdomain Text duplicate Body Lifts
/weight-loss-skin-removal/Subdomain Text duplicate Arm Lifts
/weight-loss-skin-removal/Subdomain Text duplicate Thigh Lifts
/dr-ferguson/Subdomain Board Certification & Recognition
A-TITLE Board Certification & Recognition
https://www.americanboardcosme...External Subdomain IMG-ALT logo abcs
https://ambrdfcs.org/External IMG-ALT Screenshot 2023 08 09 163533
https://www.americanboardoflas...External Subdomain IMG-ALT American board laser surgery logo
https://www.abohns.org/External Subdomain IMG-ALT american board otolaryngology head neck surgery logo
https://www.abfprs.org/External Subdomain IMG-ALT ABFPRS Logo 1.png
/dr-ferguson/Subdomain Top Cosmetic Surgeon On Oahu
A-TITLE Top Cosmetic Surgeon On Oahu
/dr-ferguson/Subdomain Text duplicate Top Cosmetic Surgeon On Oahu
A-TITLE Top Cosmetic Surgeon On Oahu
https://www.honolulumagazine.c...External Subdomain Honolulu Magazine
https://www.instagram.com/p/BU...External Subdomain 102.7 Da Bomb
https://www.youtube.com/watch?...External Subdomain KOHN2
https://www.honolulumagazine.c...External Subdomain Text duplicate Honolulu Magazine
https://www.instagram.com/p/BU...External Subdomain Text duplicate 102.7 Da Bomb
https://www.youtube.com/watch?...External Subdomain Text duplicate KOHN2
https://hawaii-newspaper.com/s...External Anchor IMG-ALT sabestof
https://www.kitv.com/island-st...External Subdomain IMG-ALT kitv
https://www.outcarehealth.org/...New window External Subdomain IMG-ALT outcare logo horiz
https://g.page/r/CXEXhFxqRgK8E...New window External No Text
https://www.yelp.com/biz/the-f...New window External Subdomain No Text
https://www.groupon.com/biz/ho...New window External Subdomain No Text
https://www.realself.com/dr/jo...New window External Subdomain No Text
https://g.page/r/CXEXhFxqRgK8E...New window External Leave a Review
/read-reviews/New window Subdomain Text duplicate Read Reviews
/medspa/New window Subdomain IMG-ALT medspa hawaii banner
https://beautyelite.repeatmd.app/External Subdomain No Text
https://beautyelite.repeatmd.com/External Subdomain IMG-ALT botox
https://beautyelite.repeatmd.com/External Subdomain Sign Up for $20/Month
https://beautyelite.repeatmd.com/External Subdomain Text duplicate IMG-ALT botox
https://beautyelite.repeatmd.com/External Subdomain IMG-ALT silverwoman
https://beautyelite.repeatmd.com/External Subdomain Sign Up for $99/Month
https://beautyelite.repeatmd.com/External Subdomain Text duplicate IMG-ALT silverwoman
https://beautyelite.repeatmd.com/External Subdomain IMG-ALT gold
https://beautyelite.repeatmd.com/External Subdomain Sign Up for $149/Month
https://beautyelite.repeatmd.com/External Subdomain Text duplicate IMG-ALT gold
https://beautyelite.repeatmd.com/External Subdomain IMG-ALT platinum
https://beautyelite.repeatmd.com/External Subdomain Sign Up for $199/Month
https://beautyelite.repeatmd.com/External Subdomain Text duplicate IMG-ALT platinum
https://app.patientfi.com/v2/b...External Subdomain No Text
/product/breast-augmentation-i...Subdomain Sale! Breast Augmentation (Injectable Addon) From $0.00
IMG-ALT implantfiller
/product/breast-augmentation-i...Nofollow Subdomain Select options
/product/injectable-deposit/Subdomain Injectable Deposit $50.00
IMG-ALT depositinject
/?add-to-cart=15169Nofollow Add to cart
/product/spring-awakening-eye-...Subdomain Spring Awakening: Eye Enhancement Package $2,625.00
IMG-ALT springawakening
/?add-to-cart=18213Nofollow Text duplicate Add to cart
/contact/Subdomain Tranquil Mountain & Ocean views in Kaka’ako, Honolulu
A-TITLE Tranquil Mountain & Ocean views in Kaka’ako, Honolulu
/contact/Subdomain Contact:
/cdn-cgi/l/email-protectionText duplicate [email protected]
/policy/Subdomain Shopping & Privacy Policies
/my-account/Subdomain My account
/checkout/Subdomain Checkout
https://thefergusonclinic.com/New window IMG-ALT cropped fav
/cdn-cgi/l/email-protectionText duplicate [email protected]
https://www.facebook.com/TheFe...New window External Subdomain No Text
https://www.instagram.com/thef...New window External Subdomain No Text
https://www.youtube.com/channe...New window External Subdomain No Text
https://www.yelp.com/biz/the-f...New window External Subdomain No Text
https://www.google.com/maps/pl...New window External Subdomain No Text
https://www.google.com/maps/pl...New window External Subdomain Text duplicate 677 Ala Moana Blvd #1011 Honolulu (Kaka'ako)
/cdn-cgi/l/email-protectionText duplicate [email protected]
https://www.facebook.com/Beaut...New window External Subdomain No Text
https://www.instagram.com/beau...New window External Subdomain No Text
https://www.google.com/maps/pl...New window External Subdomain No Text
/medspaNew window IMG-ALT tfc-bdh circle
/cdn-cgi/l/email-protectionText duplicate [email protected]

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.thefergusonclinic.com/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
The web server transmits the web page (HTML) in compressed form.
Performance
(Somewhat important)
The page response time is very slow (2.91 seconds). The response time should be less than 0.4 seconds. Slow websites are bad for search engine bots and also result in bad user experience.
The file size of the HTML document is fine (308 kB).

HTTP Response Header

NameValue
dateThu, 03 Apr 2025 22:42:32 GMT
content-typetext/html; charset=UTF-8
x-jetpack-boost-cachemiss
link<https://www.thefergusonclinic.com/>; rel=shortlink
cf-cache-statusDYNAMIC
report-to{"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v4?s=8Kfkc%2BbDdd4mVzxN8HJ96ek2%2FTQ20BVKNMc%2BICvNZIK0syJIMCVR7ESKgLDqtx3UrGVlIZ9w4%2B2jEK8FJIG%2BU8DPeuj5x%2F40Gbz1uoCqX6YbWIg0P7RBuuuelpZvepdim%2B7afvuxG4Kbg8UC"}],"group":"cf-nel","max_age":604800}
nel{"success_fraction":0,"report_to":"cf-nel","max_age":604800}
servercloudflare
cf-ray92ac1465ce2dd473-CDG
content-encodingzstd
alt-svch3=":443"; ma=86400
server-timingcfL4;desc="?proto=TCP&rtt=13556&min_rtt=13533&rtt_var=3839&sent=6&recv=8&lost=0&retrans=0&sent_bytes=3439&recv_bytes=915&delivery_rate=213774&cwnd=252&unsent_bytes=0&cid=14968a90e8e776a8&ts=612&x=0"
statuscode200
http_versionHTTP/2

External factors

This website has excellent links from other websites.
This page has backlinks from 68 referring domains.
This page has 144 backlinks.
This page has backlinks from 63 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

#****************************************************************************
# robots.txt
#     : Robots, spiders, and search engines use this file to detmine which 
#       content they should *not* crawl while indexing your website.
#     : This system is called "The Robots Exclusion Standard."
#     : It is strongly encouraged to use a robots.txt validator to check
#       for valid syntax before any robots read it!
#
# Examples:
#
# Instruct all robots to stay out of the admin area.
#     : User-agent: *
#     : Disallow:   /admin/
#
# Restrict Google and MSN from indexing your images.
#     : User-agent: Googlebot
#     : Disallow:   /images/
#     : User-agent: MSNBot
#     : Disallow:   /images/
#****************************************************************************

User-agent: *
Disallow:

Similar sites

Search preview

www.thefergusonclinic.com
Cosmetic Plastic Surgery | Honolulu, HI
Looking for plastic surgery Oahu? The Ferguson Clinic's state-of-the-art cosmetic plastic surgery center & medspa covers all your aesthetic needs in the heart of Honolulu, Hawaii.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Surgery72%Check
Ferguson72%Check
Cosmetic72%Check
Plastic72%Check
Plastic Surgery72%Check
Cosmetic Surgery72%Check
Cosmetic Plastic Surgery72%Check
Ferguson Clinic71%Check
Surgery Clinic71%Check
Hawaii70%Check
Show more keywords and terms

Automatically check thefergusonclinic.com including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions